Supplementary information: Biocatalysis on the surface of Escherichia coli: melanin pigmentation of the cell. exterior
|
|
- Sakari Hämäläinen
- 6 vuotta sitten
- Katselukertoja:
Transkriptio
1 Supplementary information: Biocatalysis on the surface of Escherichia coli: melanin pigmentation of the cell exterior Martin Gustavsson, David Hörnström, Susanna Lundh, Jaroslav Belotserkovsky, Gen Larsson * Division of Industrial Biotechnology, School of Biotechnology, KTH Royal Institute of Technology, Albanova University Center, SE 69 Stockholm, SWEDEN
2 A His6-tag B Myc-tag Untreated cells Trypsinized cells Cell ocunt Supplementary fig. S Proteolytic treatment of cell surface expressed tyrosinase (Tyr-AIDA c ) in E. coli as detected by flow cytometric analysis of fluorescent antibodies against the (A) His 6 -tag and (B) Myc-tag flanking the enzyme. Cells treated with trypsin (yellow) and untreated cells (blue).
3 A B D Myc-tag Myc-tag Negative control Positive control c Tyr-AIDA c Tyr_core-AIDA Negative control Positive control Tyr-AIDAc Tyr_core-AIDAc C His6-tag His6-tag Supplementary fig. S Comparison of cells expressing either Tyr-AIDAc (A, C) or the engineered Tyr_coreAIDAc enzyme (B, D) on the surface of E. coli cells as detected by flow cytometric analysis of fluorescent antibodies against the His6-tags (A, B) and the Myc-tags (C, D). Negative control (dark blue) is cells lacking surface expression system, while positive control (light blue) is cells expressing the paida vector without any passenger.
4 Supplementary fig. S Homology model of R. etli tyrosinase (blue) as positioned at top of the template crystal structure chosen as the B. megaterium tyrosinase (red) and where the homology model reveals the typical extensions of the C- and N-terminal of this enzyme. The engineered R. etli-core tyrosinase (Tyr_core) was designed by removal of these regions in an attempt to reduce the size and thus increase the possibility for surface display. 4
5 A B C Negative control c Tyr-AIDA expressing cells Side scatter Side scatter Forward scatter Forward scatter Supplementary fig. S4 Flow cytometric analysis of cells expressing Tyr-AIDA c with a melanin coated surface compared to a reference with an empty vector, both treated with 6D melanin specific antibodies. Side scatter plotted against forward scatter of cells expressing Tyr-AIDA c (A), and the corresponding plot for cells expressing the AIDA c without passenger (B). Histogram (C) visualizing the fluorescence profile of the Tyr-AIDA c expressing cells (green) as compared to reference cells expressing AIDA c without passenger (red). 5
6 Supplementary text Nucleotide sequence for Tyr: ATGGGTAACAAGTATAGAGTTAGAAAAAACGTATTACATCTTACCGAC ACGGAAAAAAGAGATTTTGTTCGTACCGTGCTAATACTAAAGGAAAAA GGGATATATGACCGCTATATAGCCTGGCATGGTGCAGCAGGTAAATTT CATACTCCTCCGGGCAGCGATCGAAATGCAGCACATATGAGTTCTGCT TTTTTACCGTGGCATCGTGAATACCTTTTACGATTCGAACGTGACCTTC AGTCAATCAATCCAGAAGTAACCCTTCCTTATTGGGAATGGGAAACGG ACGCACAGATGCAGGATCCCTCACAATCACAAATTTGGAGTGCAGATT TTATGGGAGGAAACGGAAATCCCATAAAAGATTTTATCGTCGATACCG GGCCATTTGCAGCTGGGCGCTGGACGACGATCGATGAACAAGGAAATC CTTCCGGAGGGCTAAAACGTAATTTTGGAGCAACGAAAGAGGCACCTA CACTCCCTACTCGAGATGATGTCCTCAATGCTTTAAAAATAACTCAGTA TGATACGCCGCCTTGGGATATGACCAGCCAAAACAGCTTTCGTAATCA GCTTGAAGGATTTATTAACGGGCCACAGCTTCACAATCGCGTACACCG TTGGGTTGGCGGACAGATGGGCGTTGTGCCTACTGCTCCGAATGATCCT GTCTTCTTTTTACACCACGCAAATGTGGATCGTATTTGGGCTGTATGGC AAATTATTCATCGTAATCAAAACTATCAGCCGATGAAAAACGGGCCAT TTGGTCAAAACTTTAGAGATCCGATGTACCCTTGGAATACAACCCCTG AAGACGTTATGAACCATCGAAAGCTTGGGTACGTATACGATATAGAAT TAAGAAAATCAAAACGTTCCTCATAA 6
7 Supplementary text Amino acid sequence for Tyr (Genbank accession number: AAM5497). The underlined amino acids constitute the truncated Tyr_core. MPWLVGKPSLERSWNAILSFPESGFQLECRNTIGSSVFSSHFTLHFRVARRLLHFS CRRFTETQKEPTQALWWCELPTAPAPRRRGTGLKAALILAKDNSNPRESKMSITR RHVIVQGGVIAAGLLASGLPGTKAFAQIPSIPWRRSLQGLAWNDPIIETYRDAVRL LNALPASDKFNWVNLSKIHGSGDVVKYCPHGNWYFLPWHRAYTAMYERIVRH VTKNNDFAMPFWDWTDNPYLPEVFTMQKTPDGKDNPLYVSSRTWPITQPMPDN IVGPQVLNTILTAKPYEVFGTTRPEGQNSLDPSWVTTSSGTQGALEYTPHNQVHN NIGGWMPEMSSPRDPIFFMHHCNIDRIWATWNLRNANSTDRLWADMPFTDNFY DVDGNFWSPKVSDLYVPEELGYNYGFRTYFKVAAASAKTLALNDKLTSVIAAT ATDAAIAGVTTTSTDNSKAATENVPLSLPIKIPAGALQEIVRQPPLPSGMDTMDFG AAQEQAASAPRVLAFLRDVEITSASTTSVRVFLGKNDLKADTPVTDPHYVGSFA VLGHDGDHHRKPSFVLDLTDAIQRVYGGRGQTDGEAIDLQLIPVGSGAGKPGAV EPAKLEIAIVSA 7
tgg agg Supplementary Figure S1.
ttaggatattcggtgaggtgatatgtctctgtttggaaatgtctccgccattaactcaag tggaaagtgtatagtaatgaatctttcaagcacacagatcacttcaaaagactgtttcaa catcacctcaggacaaaaagatgtactctcatttggatgctgtgatgccatgggtcacag attgcaattcccaagtgcccgttcttttacaccaaaatcaaagaagaatatctccccttt
Plasmid Name: pmm290. Aliases: none known. Length: bp. Constructed by: Mike Moser/Cristina Swanson. Last updated: 17 August 2009
Plasmid Name: pmm290 Aliases: none known Length: 11707 bp Constructed by: Mike Moser/Cristina Swanson Last updated: 17 August 2009 Description and application: This is a mammalian expression vector for
Experimental Identification and Computational Characterization of a Novel. Extracellular Metalloproteinase Produced by Clostridium sordellii
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 207 Supplementary Information Experimental Identification and Computational Characterization of
Supporting Information for
Supporting Information for Analysis of Sogatella furcifera proteome that interact with P10 protein of Southern rice black-streaked dwarf virus Win Than*, Faliang Qin*, Wenwen Liu, Xifeng Wang ** State
The CCR Model and Production Correspondence
The CCR Model and Production Correspondence Tim Schöneberg The 19th of September Agenda Introduction Definitions Production Possiblity Set CCR Model and the Dual Problem Input excesses and output shortfalls
Methods S1. Sequences relevant to the constructed strains, Related to Figures 1-6.
Methods S1. Sequences relevant to the constructed strains, Related to Figures 1-6. A. Promoter Sequences Gal4 binding sites are highlighted in the color referenced in Figure 1A when possible. Site 1: red,
LX 70. Ominaisuuksien mittaustulokset 1-kerroksinen 2-kerroksinen. Fyysiset ominaisuudet, nimellisarvot. Kalvon ominaisuudet
LX 70 % Läpäisy 36 32 % Absorptio 30 40 % Heijastus 34 28 % Läpäisy 72 65 % Heijastus ulkopuoli 9 16 % Heijastus sisäpuoli 9 13 Emissiivisyys.77.77 Auringonsuojakerroin.54.58 Auringonsäteilyn lämmönsiirtokerroin.47.50
MALE ADULT FIBROBLAST LINE (82-6hTERT)
Double-stranded methylation patterns of a 104-bp L1 promoter in DNAs from male and female fibroblasts, male leukocytes and female lymphoblastoid cells using hairpin-bisulfite PCR. Fifteen L1 sequences
Supporting information
Supporting information Figure S1. Carotenoid biosynthesis pathway in papaya fruit which is adopted from Blas et al. (2010) (reference 4) and Nisar et al. (2015) (reference 5). Carotenoids are synthesized
FETAL FIBROBLASTS, PASSAGE 10
Double-stranded methylation patterns of a 104-bp L1 promoter in DNAs from fetal fibroblast passages 10, 14, 17, and 22 using barcoded hairpinbisulfite PCR. Fifteen L1 sequences were analyzed for passages
VIIKKI BIOCENTER University of Helsinki
VIIKKI BIOCENTER University of Helsinki Biologian DNA koodi ja sen selvittäminen Petri Auvinen DNA Sequencing and Genomics Laboratory Institute of Biotechnology Kuinka solut kehittyivät? Kolmenlaisia soluja
Reliable diagnostic support Ultra-light design
EN Powerful illumination Intelligent charging management Reliable diagnostic support Ultra-light design VISIOMED Optima UV original scale 1:1 VISIOMED Optima Quality Made Easy and an illumination close
Kitchen Pendant 2/10/19
Kitchen Pendant Kitchen Pendant Dining Area Dining Area Living Area Dining Area Bathroom 201 Quantity: 2 W A L L C O L L E C T I O N Voto Wall Square DESCRIPTION The Voto light by Tech Lighting is simply
Alternative DEA Models
Mat-2.4142 Alternative DEA Models 19.9.2007 Table of Contents Banker-Charnes-Cooper Model Additive Model Example Data Home assignment BCC Model (Banker-Charnes-Cooper) production frontiers spanned by convex
Returns to Scale II. S ysteemianalyysin. Laboratorio. Esitelmä 8 Timo Salminen. Teknillinen korkeakoulu
Returns to Scale II Contents Most Productive Scale Size Further Considerations Relaxation of the Convexity Condition Useful Reminder Theorem 5.5 A DMU found to be efficient with a CCR model will also be
4 Mil Clear. Physical properties nominal. Film performance. www.solargard.co.uk. Safety & Security Window Films Armorcoat
4 Mil Clear % Transmittance 77 64 % Absorptance 15 23 % Reflectance 8 13 % Transmittance 89 80 % Reflectance exterior 9 16 % Reflectance interior 9 16 Emissivity.90.90 Winter U-Factor (W/m² C) 6.04 2.76
mtorc1 and CK2 coordinate ternary and eif4f complex assembly
mtorc1 and CK2 coordinate ternary and eif4f complex assembly Valentina Gandin 1,2,3,4 *, Laia Masvidal 5 *, Marie Cargnello 1,2,3,4 *, Laszlo Gyenis 6, Shannon McLaughlan 1,2,3,4, Yutian Cai 1,2,3,4, Clara
I. Principles of Pointer Year Analysis
I. Principles of Pointer Year Analysis Fig 1. Maximum (red) and minimum (blue) pointer years. 1 Fig 2. Principle of pointer year calculation. Fig 3. Skeleton plot graph created by Kinsys/Kigraph programme.
Capacity Utilization
Capacity Utilization Tim Schöneberg 28th November Agenda Introduction Fixed and variable input ressources Technical capacity utilization Price based capacity utilization measure Long run and short run
Yrityksen informaatio- ja toimintoprosessien optimointi
Yrityksen informaatio- ja toimintoprosessien optimointi V-S Teknologiateollisuus ry vaalikokous 10.11.2008 Thomas Westerholm Åbo Akademi PBI Research Institute Teknologisen kehityksen taustalla Copyright
Vallila coated fabrics. Vallila vahakankaat
Vallila coated fabrics Vallila vahakankaat Acrylic coated fabrics (100% cotton) 2 Africa 120405 Design: Howard Smith Aurajoki 001765 Design: Riina Kuikka 122 blue 8 beige Artisokka 001680 Design: Saara
3 9-VUOTIAIDEN LASTEN SUORIUTUMINEN BOSTONIN NIMENTÄTESTISTÄ
Puhe ja kieli, 27:4, 141 147 (2007) 3 9-VUOTIAIDEN LASTEN SUORIUTUMINEN BOSTONIN NIMENTÄTESTISTÄ Soile Loukusa, Oulun yliopisto, suomen kielen, informaatiotutkimuksen ja logopedian laitos & University
Basset: Learning the regulatory code of the accessible genome with deep convolutional neural networks. David R. Kelley
Basset: Learning the regulatory code of the accessible genome with deep convolutional neural networks David R. Kelley DNA codes for complex life. How? Kundaje et al. Integrative analysis of 111 reference
Enterprise Architecture TJTSE Yrityksen kokonaisarkkitehtuuri
Enterprise Architecture TJTSE25 2009 Yrityksen kokonaisarkkitehtuuri Jukka (Jups) Heikkilä Professor, IS (ebusiness) Faculty of Information Technology University of Jyväskylä e-mail: jups@cc.jyu.fi tel:
Stormwater filtration unit
Stormwater filtration unit Background, concept and applied design work Olli Hakala 2018 WSP Finland Aalto university Kyttä ym. 2014. Veden äärellä kysely, ENTJUSTESS-hanke. Aalto yliopisto. STORMWATER
Supplementary Information
Supplementary Information Supplementary Table 1. Strain table Strain name Genotype Reference CEN.PK111-27B MATa leu2 trp1 Euroscarf TC-49 TC-50 pdc5::aro4* aro10::aro7* This study TC-50 MATa leu2 trp1
Title: Enhancement of protein production via the strong DIT1 terminator and two RNA-binding proteins in Saccharomyces cerevisiae
Title: Enhancement of protein production via the strong DIT1 terminator and two RNA-binding proteins in Saccharomyces cerevisiae Authors: Yoichiro Ito, Takao Kitagawa, Mamoru Yamanishi, Satoshi Katahira,
Plasmid construction PCR reactions were carried out with Pfu or Pfu turbo polymerases (Stratagene) unless otherwise stated.
Expanding the Genetic Code of Yeast for Incorporation of Diverse Unnatural Amino Acids via a Pyrrolysyl-tRNA Synthetase/tRNA Pair Susan M. Hancock 1, Rajendra Uprety 2, Alexander Deiters 2 & Jason W. Chin
ReFuel 70 % Emission Reduction Using Renewable High Cetane Number Paraffinic Diesel Fuel. Kalle Lehto, Aalto-yliopisto 5.5.
ReFuel 70 % Emission Reduction Using Renewable High Cetane Number Paraffinic Diesel Fuel Kalle Lehto, Aalto-yliopisto 5.5.2011 Otaniemi ReFuel a three year research project (2009-2011) goal utilize the
Lausuntopyyntöluettelo HUOM. Komiteoiden ja seurantaryhmien kokoonpanot on esitetty SESKOn komitealuettelossa
1(11) pren ISO 15223-1 rev Medical devices - Symbols to be used with medical device labels, labelling and information to be supplied - Part 1: General requirements Kansainvälinen valmisteluvaihe: 90/385/EEC,
Mesoporous silicon for increasing drug bioavailability: from material to tablets
23rd Annual Symposium of the Finnish Society of Physical Pharmacy 9 th February 2012 Mesoporous silicon for increasing drug bioavailability: from material to tablets Luis Maria Bimbo Division of Pharmaceutical
lpar1 IPB004065, IPB002277, and IPB Restriction Enyzme Differences from REBASE Gained in Variant Lost from Reference
lpar1 IPB465, IPB2277, and IPB5385 Genomic Sequence Coding Sequence For help interpreting these results, view the PARSENP Introduction page. # View On Sequence Nucleotide Change Effect Restriction Enyzme
National Building Code of Finland, Part D1, Building Water Supply and Sewerage Systems, Regulations and guidelines 2007
National Building Code of Finland, Part D1, Building Water Supply and Sewerage Systems, Regulations and guidelines 2007 Chapter 2.4 Jukka Räisä 1 WATER PIPES PLACEMENT 2.4.1 Regulation Water pipe and its
Strain or plasmid Description a Reference or source b. 168 trpc2 Laboratory. 1A780 trpc2 sigb::spc BGSC
TABLE S1 Bacterial strains and plasmids Strain or plasmid Description a Reference or source b B. subtilis 168 trpc2 Laboratory stock 1A780 trpc2 sigb::spc BGSC BM1010 trpc2 htpx::pgs1582; Em r BM1302 trpc2
Rekisteröiminen - FAQ
Rekisteröiminen - FAQ Miten Akun/laturin rekisteröiminen tehdään Akun/laturin rekisteröiminen tapahtuu samalla tavalla kuin nykyinen takuurekisteröityminen koneille. Nykyistä tietokantaa on muokattu niin,
Voitelulaitteen kannessa olevalla säätöruuvilla voidaan ilmaan sekoittuvan öljyn määrä säätää helposti.
LUETTELO > 2015 > Sarja MD voitelulaitteet Sarja MD voitelulaitteet Uutta Liitännät vaihdettavin patruunoin: sisäkierre (1/8, 1/4, /8) tai pistoliittimet Ø 6, 8 ja 10 mm putkelle. Modulaarinen asennus
KONEISTUSKOKOONPANON TEKEMINEN NX10-YMPÄRISTÖSSÄ
KONEISTUSKOKOONPANON TEKEMINEN NX10-YMPÄRISTÖSSÄ https://community.plm.automation.siemens.com/t5/tech-tips- Knowledge-Base-NX/How-to-simulate-any-G-code-file-in-NX- CAM/ta-p/3340 Koneistusympäristön määrittely
Functional Genomics & Proteomics
Functional Genomics & Proteomics Genome Sequences TCACAATTTAGACATCTAGTCTTCCACTTAAGCATATTTAGATTGTTTCCAGTTTTCAGCTTTTATGACTAAATCTTCTAAAATTGTTTTTCCCTAAATGTATATTTTAATTTGTCTCAGGAGTAGAATTTCTGAGTCATAAAGCGGT CATATGTATAAATTTTAGGTGCCTCATAGCTCTTCAAATAGTCATCCCATTTTATACATCCAGGCAATATATGAGAGTTCTTGGTGCTCCACATCTTAGCTAGGATTTGATGTCAACCAGTCTCTTTAATTTAGATATTCTAGTACAT
Underpinning Phage Arbitrium Communication Systems
Molecular Cell, Volume 74 Supplemental Information Deciphering the Molecular Mechanism Underpinning Phage Arbitrium Communication Systems Francisca Gallego del Sol, José R. Penadés, and Alberto Marina
7.4 Variability management
7.4 Variability management time... space software product-line should support variability in space (different products) support variability in time (maintenance, evolution) 1 Product variation Product
Läpimurto ms-taudin hoidossa?
Läpimurto ms-taudin hoidossa? Läpimurto ms-taudin hoidossa? Kansainvälisen tutkijaryhmän kliiniset kokeet uudella lääkkeellä antoivat lupaavia tuloksia sekä aaltoilevan- että ensisijaisesti etenevän ms-taudin
Other approaches to restrict multipliers
Other approaches to restrict multipliers Heikki Tikanmäki Optimointiopin seminaari 10.10.2007 Contents Short revision (6.2) Another Assurance Region Model (6.3) Cone-Ratio Method (6.4) An Application of
Graphic guidelines. December 2009
Graphic guidelines December 2009 Logotype Logotype Colour positive Grayscale Black Negative (White) Logotype safe area X X X X X Graphic element Colours Green Pantone 370 C 56 M 0 Y 100 K 27 R 74 G 126
FYSE301(Elektroniikka(1(A3osa,(kevät(2013(
FYSE301(Elektroniikka(1(A3osa,(kevät(2013( 1/2 Loppukoe1.3.2013 vastaakaikkiinkysymyksiin(yhteensä48pistettä) 1. Kuvailelyhyesti a. Energialineaarisissapiirielementeissä:vastuksessa,kondensaattorissajakelassa(3
22.1.2013. truck Check In. truck Check Net. ewaybill ja ajat suoraan terminaaliin
ja ajat suoraan terminaaliin 1 Konseptit Mussalon Merituulessa ja Vuosaaren Porttitalossa sijaitsevat kioskisovellukset, joilla rekkakuskit voivat itse tehdä konttikeikat autoilleen ennen sisäänajoa satama-alueen
Työsuojelurahaston Tutkimus tutuksi - PalveluPulssi 11.3.2016. Peter Michelsson Wallstreet Asset Management Oy
Työsuojelurahaston Tutkimus tutuksi - PalveluPulssi 11.3.2016 Peter Michelsson Wallstreet Asset Management Oy Wallstreet lyhyesti Perustettu vuonna 2006, SiPa toimilupa myönnetty 3/2014 Täysin kotimainen,
IT-projekti. Mitä #&!% siellä tapahtuu?
IT-projekti. Mitä #&!% siellä tapahtuu? Sporttirekisteripäivät 8.10.2014! Tapio Järvenpää Chief Disruption Officer, Motley Agency Ltd @Tapsa_Jpaa @MotleyAgency Mistä tietää, että suuri IT-projekti
Efficiency change over time
Efficiency change over time Heikki Tikanmäki Optimointiopin seminaari 14.11.2007 Contents Introduction (11.1) Window analysis (11.2) Example, application, analysis Malmquist index (11.3) Dealing with panel
Vuokrakalusteet Rental furniture
Vuokrakalusteet Rental furniture 2015 ARENA 2015 11.11.2015 klo. 9-16 Rakennusaika tiistai 10.11 klo. 15-18 ARENA perusoasto / basic stand 1 x 3m, h=2,5m Uusi infotiski / New info counter ARENA osasto
TÄUBLER OY. Vuorimiehenkatu Helsinki Finland. Puh: Fax:
TÄUBLER OY Vuorimiehenkatu 21 00140 Helsinki Finland Puh: 09-175 491 Fax: 09-175 735 TÄUBLER OY Perustettu vuonna 1990 Itsenäinen suomalainen yritys Myy ja markkinoi edustamiaan tuotteita; SIEMENS H+H
Valmiustaitoja biokemisteille
Valmiustaitoja biokemisteille - Power Point -ohjelman käyttö - seminaariesitelmän laatiminen ja esittäminen Tuomo Glumoff 1. Power Point -ohjelman käyttö - teksti - kuvat - tausta - valmiit pohjat * löytyy
AUTO AIR COLORS HINNASTO
120ml 480ml 960ml 4001 Sealer White -04 11,50-16 44,00-32 83,00 4002 Sealer Dark -04 11,50-16 44,00-32 83,00 4004 Transparent Base -04 7,70-16 29,50-32 55,50 4007 Airbrush Cleaner -04 7,70-16 29,50-32
performance DHW coil type exchanger Diverter valve Analogue thermostat control panel Heating pump DHW pump Digital electronic control panel
ACTIVA HIGH PERFORMANCE STEEL HEATER UNIT HIGH PERFORMANCE STEEL HEATER UNIT ACTIVA PLUS High energy efficiency obtained due to the LASIAN body structural features of high heat exchange surface area and
Changes in the drawing are allowed only by the permission of the authorities who have granted the certificate Muutokset sallittu vain sertifikaatin my
Changes in the drawing are allowed only by the permission of the authorities who have granted the certificate Muutokset sallittu vain sertifikaatin myöntäjän luvalla The drawing is a valid document only
VIIKKI BIOCENTER University of Helsinki
VIIKKI BIOCENTER University of Helsinki Mitä uudet DNA sekvensointimenetelmät voivat paljastaa luonnonjärjestelmästä? Petri Auvinen DNA Sequencing and Genomics Laboratory Institute of Biotechnology Petri
Lataa Cognitive Function in Opioid Substitution Treated Patiens - Pekka Rapeli. Lataa
Lataa Cognitive Function in Opioid Substitution Treated Patiens - Pekka Rapeli Lataa Kirjailija: Pekka Rapeli ISBN: 9789523022232 Sivumäärä: 173 Formaatti: PDF Tiedoston koko: 11.54 Mb Opioid substitution
Travel Getting Around
- Location Olen eksyksissä. Not knowing where you are Voisitko näyttää kartalta missä sen on? Asking for a specific location on a map Mistä täällä on? Asking for a specific...wc?...pankki / rahanvaihtopiste?...hotelli?...huoltoasema?...sairaala?...apteekki?...tavaratalo?...ruokakauppa?...bussipysäkki?
Changes in the drawing are allowed only by the permission of the authorities who have granted the certificate Muutokset sallittu vain sertifikaatin my
Changes in the drawing are allowed only by the permission of the authorities who have granted the certificate Muutokset sallittu vain sertifikaatin myöntäjän luvalla The drawing is a valid document only
AUTO AIR COLORS HINNASTO
120ml 480ml 960ml 4001 Sealer White -04 10,10-16 38,50-32 73,00 4002 Sealer Dark -04 10,10-16 38,50-32 73,00 4004 Transparent Base -04 6,70-16 25,50-32 48,50 4007 Airbrush Cleaner -04 6,70-16 25,50-32
Vakiorakenteet / Standard elements
Vakiorakenteet / Standard elements Esimerkkejä varastossa olevista vakiokalusteista. Hinnat sisältävät tuotteen toimituksen osastolle. Hintoihin lisätään voimassaoleva alv. Kuvaston kalusteita on rajoitetusti,
No Problem TARJOTTIMET 1.3.2012
No Problem TARJOTTIMET 1.3.2012 Tuotetietoja Kaikki No Problem tarjottimet on käsintehtyjä, tuote kerrallaan. Yhdessä tarjottimessa voi olla jopa 8 kerrosta viilua, koosta riippuen. Paikallisesti valmistettu
ELINPATOLOGIAN RYHMÄOPETUS MUNUAINEN
ELINPATOLOGIAN RYHMÄOPETUS MUNUAINEN KYSYMYKSET: 1. Glomeruluksen rakenne. Mihin seikkoihin perustuu valikoiva läpäiseväisyys veri- ja virtsatilan välillä? 2. Glomerulusvaurion mekanismit A. Immunologiset
Lapuan myöntämä EU tuki SOLUTION asuinalueille omakoti- tai rivitaloa rakentaville
Lapuan myöntämä EU tuki SOLUTION asuinalueille omakoti- tai rivitaloa rakentaville Pakollinen liite rakennustyön tarkastusasiakirjaan ja toiseen hakuvaiheeseen / Compulsory supplement the construction
WAMS 2010,Ylivieska Monitoring service of energy efficiency in housing. 13.10.2010 Jan Nyman, jan.nyman@posintra.fi
WAMS 2010,Ylivieska Monitoring service of energy efficiency in housing 13.10.2010 Jan Nyman, jan.nyman@posintra.fi Background info STOK: development center for technology related to building automation
4x4cup Rastikuvien tulkinta
4x4cup Rastikuvien tulkinta 4x4cup Control point picture guidelines Päivitetty kauden 2010 sääntöihin Updated for 2010 rules Säännöt rastikuvista Kilpailijoiden tulee kiinnittää erityistä huomiota siihen,
Capacity utilization
Mat-2.4142 Seminar on optimization Capacity utilization 12.12.2007 Contents Summary of chapter 14 Related DEA-solver models Illustrative examples Measure of technical capacity utilization Price-based measure
Social and Regional Economic Impacts of Use of Bioenergy and Energy Wood Harvesting in Suomussalmi
Social and Regional Economic Impacts of Use of Bioenergy and Energy Wood Harvesting in Suomussalmi Green Cities and Settlements 18.2.2014 Ville Manninen Writers Project group Sirpa Korhonen, Anna Mari
MEETING PEOPLE COMMUNICATIVE QUESTIONS
Tiistilän koulu English Grades 7-9 Heikki Raevaara MEETING PEOPLE COMMUNICATIVE QUESTIONS Meeting People Hello! Hi! Good morning! Good afternoon! How do you do? Nice to meet you. / Pleased to meet you.
1. SIT. The handler and dog stop with the dog sitting at heel. When the dog is sitting, the handler cues the dog to heel forward.
START START SIT 1. SIT. The handler and dog stop with the dog sitting at heel. When the dog is sitting, the handler cues the dog to heel forward. This is a static exercise. SIT STAND 2. SIT STAND. The
LYTH-CONS CONSISTENCY TRANSMITTER
LYTH-CONS CONSISTENCY TRANSMITTER LYTH-INSTRUMENT OY has generate new consistency transmitter with blade-system to meet high technical requirements in Pulp&Paper industries. Insurmountable advantages are
Online Supplement 1 Foudi et al. 2008
Online Supplement 1 Foudi et al. 2008 This supplementary file contains: I) Supplementary Figures 1-10 II) Supplementary References (38-42) M2-rtT ROS26 S M2-rtT -globin poly + doxycycline S+poly TetOP
HARJOITUS- PAKETTI A
Logistiikka A35A00310 Tuotantotalouden perusteet HARJOITUS- PAKETTI A (6 pistettä) TUTA 19 Luento 3.Ennustaminen County General 1 piste The number of heart surgeries performed at County General Hospital
DAKAR 1803 DAKAR 1805 DAKAR 1807
SPRING-SUMMER 2018 2 DAKAR 1803 DAKAR 1805 DAKAR 1807 Beige Grey DAKAR 1808 DAKAR 1809 PATCHWORK 1800 PATCHWORK 1801 S40 EERO GEN 3 Beige Blue Brown BASEBALL 1800 Black Navy Grey Stone BASEBALL 1802 Beige
ELECTRIC SAUNA HEATERS. Experience the Genuine Finnish Sauna. Experience SAWO.
ELECTRIC SAUNA HEATERS Experience the Genuine Finnish Sauna. Experience SAWO. Mini,,0, Separate control panel or builtin controls on the left or right side of the heater Erillinen tai sisäänrakennettu
Prognos Julkaisusuunnitelmat
Prognos Julkaisusuunnitelmat Työsuunnitelmiin liittyvien raporttien ja vuosiseminaarien lisäksi suunnitellut julkaisut Casejoryt 09/2005 & JR4 25.1.2005 päivitetty tilanne Casejoryt 04/2006 päivitetty
Supplementary Material : Baker et al. 1
Supplementary Material : Baker et al. 1 Supplementary Material Title: Species identity and human consumption of beaked whales in the Gilbert Islands, Republic of Kiribati Authors: C. Scott Baker, Al Hutt,
Matchsaver on jalkapallokentän peitejärjestelmiin erikoistunut yritys ja sijaitsee Englannissa North Yorkshiren maakunnassa.!
Matchsaver on jalkapallokentän peitejärjestelmiin erikoistunut yritys ja sijaitsee Englannissa North Yorkshiren maakunnassa. Matchsaver kentänpeite on työkalu jolla säästetään niin kentän ylläpito- ja
Asennusohjeet P/N MMI , Rev. A Syyskuu ATEX -asennusohjeet Micro Motion MVD Direct Connect -mittareille
Asennusohjeet P/N MMI-20011744, Rev. A Syyskuu 2008 ATEX -asennusohjeet Micro Motion MVD Direct Connect -mittareille Huomautus: kun kyseessä ovat vaaralliset asennukset Euroopassa, katso standardia EN
Automaatiojärjestelmän hankinnassa huomioitavat tietoturva-asiat
Automaatiojärjestelmän hankinnassa huomioitavat tietoturva-asiat Teollisuusautomaation tietoturvaseminaari Purchasing Manager, Hydro Lead Buyer, Industrial Control Systems 1 Agenda / esityksen tavoite
Vuokrakalusteet Rental furniture
Vuokrakalusteet Rental furniture 2015 2.17 Kaareva infodiski / Curved infodesk R120 x 100 cm 2.16 Kaareva infodiski / Curved infodesk 90 x 50 x h52 cm ARENA perusoasto / basic stand 1 x 3m, h=2,5m ARENA
I-VALO VEGA FIXING MODULE B300
Nämä ohjeet eivät välttämättä sisällä kaikkien valaisinten tai tarvikkeiden yksityiskohtaisia ohjeita, eivätkä ohjeista kaikissa asennukseen ja käyttöön tai huoltoon liittyvissä tilanteissa. / These instructions
While we compile backlinks report, You can visit following handy links. Music download
Inbound Links Report for http://www.viheraluerakentajat.fi Please Wait... Processing backlink number Remaining backlinks to be processed While we compile backlinks report, You can visit following handy
Pro Pohjolan. perhokuvasto. www.ottiperho.com. www.ottiperho.com
Pro Pohjolan perhokuvasto 1 22 Otti lohiperhot Crystal flash kokoelma Nousulohi Laggon hopea Hopearuoste Hopeanuoli Crystal flash kokoelma 2 Veidnesin vihree Kirkas nousija Keskipäivän kirkas Keltainen
Area and population 3. Demographic changes 4. Housing 5. Municipal economy 6. Sectoral employment 7. Labour and work self-sufficiency 8
2004 Statistics Uusimaa Helsinki Region Area and population 3 Demographic changes 4 Housing 5 Municipal economy 6 Sectoral employment 7 Labour and work self-sufficiency 8 Unemployment 9 Transport 10 Age
Bounds on non-surjective cellular automata
Bounds on non-surjective cellular automata Jarkko Kari Pascal Vanier Thomas Zeume University of Turku LIF Marseille Universität Hannover 27 august 2009 J. Kari, P. Vanier, T. Zeume (UTU) Bounds on non-surjective
IBIS. General. Disc duct diffuser for supply air. Quick guide. Quick facts A I R F L O W S O U N D L E V E L. l/s IBIS. Size
Disc duct diffuser for supply air General - - Quick facts Quick guide A I R F L O W S O U N D L E V E L l/s Size 6 Technical description Design - - Materials and surface treatment - Special Planning -
Sähköjärjestelmän käyttövarmuus & teknologia Käyttövarmuuspäivä 25.11.2014
Sähköjärjestelmän käyttövarmuus & teknologia Käyttövarmuuspäivä 25.11.2014 Jarmo Partanen, professori, Lappeenrannan yliopisto jarmo.partanen@lut.fi +358 40 5066 564 Electricity Market, targets Competitive
Metropolia University of Applied Sciences. Bachelor of Laboratory Services. Laboratory Sciences. Thesis
Aleksi-Mikael Kivelä GAD65 Autoantibody Immune Responses in Newly Diagnosed Type 1 Diabetes Children and in GADA Positive Children from General Population Metropolia University of Applied Sciences Bachelor
Paikkatiedon semanttinen mallinnus, integrointi ja julkaiseminen Case Suomalainen ajallinen paikkaontologia SAPO
Paikkatiedon semanttinen mallinnus, integrointi ja julkaiseminen Case Suomalainen ajallinen paikkaontologia SAPO Tomi Kauppinen, Eero Hyvönen, Jari Väätäinen Semantic Computing Research Group (SeCo) http://www.seco.tkk.fi/
Ystävällisin terveisin Huippu Group Oy
Oletko kiinnostunut säästämään tai tekemään kannattavaa kauppaa tarviketuotteilla. Valikoima kattaa tarviketuotteet Dymo- ja Brother tarrateippitulostimiin ja etikettikirjoittimiin, eli eivät ole alkuperäistuotteita.
Supporting Information Table S1 Core regions of 18 identified promoters in C. acetobutylicum
Supporting Information Table S1 Core regions of 18 identified promoters in C. acetobutylicum Gene Core regions of the promoters Reference 35 region 10 region thl TATA TTGATA AAAATAATAATAGTGGG TATAAT TAA
Introduction to exterior routing
Introduction to exterior routing CIDR-1 Autonomous Systems AS - Autonomous System on Internetin hallinnollinen alue, eli osa verkosta, jolla on yksi omistaja. AS:lla käytössä on yleensä yksi (sisäinen)
SUORITUSTASOILMOITUS Nro: DoP [FI]
Tuotetyypin yksilöllinen tunniste: ESSVE ESSD (self-drilling) fastening screws ESSVE ESST (self-tapping) fastening screws Aiottu käyttötarkoitus (aiotut käyttötarkoitukset): The fastening screws are intended
PERFORMANCE MADE SMARTER
PERFORMANCE MADE SMARTER ä 1 o e yhteys Power up 1.0 11 1.1 1.2 Decrease setpoint Fast setpoint adjustment and relay test Increase setpoint Save and exit the menu and simultaneously = change relay state
H 7 G 8 F E D C B A 8 7 6 R35.3 6 5 R19.4 5 4 4 3 40 3 2 1 Top view Scale: 1:2 DESIGNED BY: Tapio Korpela DATE: 21.11.2007 CHECKED BY: DATE: SIZE A2 SCALE 1:1 XXX XXX WEIGHT (kg) 2,76 DRAWING NUMBER Nivelakseli
Recirkulering. El-tilslutning. Kontrolpanel. Dansk. Timerfunktion
1 2 Dansk Recirkulering Luften renses ved hjælp at aktive kulfiltre hvorefter den returneres til rummet. Kulfiltre bestilles separat. El-tilslutning Emhætten skal tilsluttes 230 V i henhold til stærkstrømsreglementet.
PUNASOLUT RYHMÄN MUKAISESTI
PUNASOLUT RYHMÄN MUKAISESTI Verikeskuspäivä 2018 Susanna Sainio Ensisijaisesti potilaan ABO- ja RhD-veriryhmän mukaisia valmisteita minimoida ABO-epäsopivien punasolujen siirrosta johtuvien hemolyyttisten
1.3Lohkorakenne muodostetaan käyttämällä a) puolipistettä b) aaltosulkeita c) BEGIN ja END lausekkeita d) sisennystä
OULUN YLIOPISTO Tietojenkäsittelytieteiden laitos Johdatus ohjelmointiin 81122P (4 ov.) 30.5.2005 Ohjelmointikieli on Java. Tentissä saa olla materiaali mukana. Tenttitulokset julkaistaan aikaisintaan
Tree map system in harvester
Tree map system in harvester Fibic seminar 12.6.2013 Lahti Timo Melkas, Metsäteho Oy Mikko Miettinen, Argone Oy Kalle Einola, Ponsse Oyj Project goals EffFibre project 2011-2013 (WP3) To evaluate the accuracy
On instrument costs in decentralized macroeconomic decision making (Helsingin Kauppakorkeakoulun julkaisuja ; D-31)
On instrument costs in decentralized macroeconomic decision making (Helsingin Kauppakorkeakoulun julkaisuja ; D-31) Juha Kahkonen Click here if your download doesn"t start automatically On instrument costs