(2002). 2. Oka, T., Toyomura, T., Honjo, K., Wada, Y. & Futai, M. Four subunit a
|
|
- Annikki Miina Siitonen
- 6 vuotta sitten
- Katselukertoja:
Transkriptio
1 References 1. Coates, J. & de Bono, M. Antagonistic pathways in neurons exposed to body fluid regulate social feeding in Caenorhabditis elegans. Nature 419, % Oxygen (2002). 2. Oka, T., Toyomura, T., Honjo, K., Wada, Y. & Futai, M. Four subunit a isoforms of Caenorhabditis elegans vacuolar H+-ATPase. Cell-specific expression during development. J. Biol. Chem. 276, (2001). 3. Yu, S., Avery, L., Baude, E. & Garbers, D. L. Guanylyl cyclase expression in specific sensory neurons: a new family of chemosensory receptors. Proc. Natl. Acad. Sci. U S A 94, (1997). 21% to 17.4% O 2 21% to 19.2% O 2 4. Okkema, P. G., Harrison, S. W., Plunger, V., Aryana, A. & Fire, A. Sequence requirements for myosin gene expression and regulation in Caenorhabditis elegans. Genetics 135, (1993). 5. Mello, C. C., Kramer, J. M., Stinchcomb, D. & Ambros, V. Efficient gene transfer in C. elegans: extrachromosomal maintenance and integration of transforming sequences. EMBO J. 10, (1991). 6. Brunori., Eraldo Antonini and Maurizio. Frontiers of Biology (lsevier, New York, North-Holland, Amsterdam, 1971). 7. Kerr, R. A. & Schafer, W. R. Intracellular Ca2+ imaging in C. elegans. Methods Mol. Biol. 351, (2006). 8. Bennett-Lovsey, R. M., Herbert, A. D., Sternberg, M. J. & Kelley, L. A. Exploring the extremes of sequence/structure space with ensemble fold recognition in the program Phyre. Proteins 70, (2008). 9. Arnold, K., Bordoli, L., Kopp, J. & Schwede, T. The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling Bioinformatics 22, (2006). Supplementary Figures Time (secs) Supplementary Figure 1. O 2 stimuli used in behavioural experiments. The graphs show O 2 levels in the behavioural arena when O 2 is switched from 21% to 19.2% (blue) or 17.4% (red). Measurements were made using fibre-optic O 2 microsensor probes (PreSens). The bars under the graph show the time intervals during which the speed of animals was measured. 7 1
2 265 recombinants 34 recombinants 2 recombinants V unc-46 dpy-11 kb Copy 1 Copy 2 Recomb 1 Recomb 2 kb Polymorphisms Supplementary Figure 2. Fine genetic mapping and molecular identification of glb- 5(Haw) By genotyping and/or phenotyping 265 Dpy-non-Unc and Unc-non-Dpy recombinants between unc-46 and dpy-11, we mapped the locus conferring Hawaiianlike responses to an 8 kb interval between the SNP at and the SNP at Recomb 1 and 2 are the two recombinants that narrow the position of the naturally varying locus to this 8 kb interval. Arrows indicate where CB4856 sequences begin in each recombinant chromosome. This interval contains 11 polymorphisms between N2 and CB4856. Ten of these are SNPs not found in other wild strains that show Hawaiian-like O 2 responses (see Supplementary Table 2). The remaining polymorphism was a partial duplication found in glb-5(bri) but not in glb- 5(Haw) allele. The unduplicated Haw allele was found in all strains that display Hawaiian-like O 2 responses (see Supplementary Table 1). Horizontal numbers refer to position, in kb, along chromosome V. Slanting numbers indicate the positions of SNPs in the region between N2 and CB4856. Shown in blue and red are the two copies of the duplication found in the N2 glb-5 allele. Boxes represent exons, lines introns. Arrowheads point direction of transcription. 2
3 a Copy 1 Copy 2 GACCTTTGAGTGCAATTAACGAGGAAATTCGTGAATACGATCAATTGAGC AGAGAACTTGAAGTTtga Glu Val Stop N b Copy 1 Copy 2 N ATTTGTgt...agacatca Cys Met Stop tgcatgtga GGTTGGCAATTCGGGGATGCTTCCTAACAATGTTAGAAAAGTATCCACAA GTTCGTCCAATTTGGGGGTTTGGAAAAAGAATTGAGGGAAGGGGTGATGA GACATGGAAGCCTGAGATCGTGGAGGATTTTTATTTTAGgtaagacgggt atcttaagtttgaagttaagagtatcatcggagagcattttttctatatt gtattacatcatgctagaaaatcataataaaacactccaaacacttttca gacttgtcaaaaatttcagtcaaagttttggcaaattgccgaattttcca aaaatgtagactatctgagtaatttttatcatagggtttaacgcctacaa aattgaaaaaaaaaatcataaaaaattttctgaaaagtcttactggcata tttggtcattttagcactatcggggcaattttaagcatttatcccgctga cgacactcactttcaataggtctagaaatttaaactggaaaaatttcaac aaataagtaactaaaaataataagataacgatttagccaacgtgttttac atggttcaattaattttaacttttctgatgttaactttttttaaactgaa agggtattgactttttaaaactaaactttttgcgcagaacattttatact tggaaaatttctagacatcattgcgcatccctccaggcagctttgaatat GATAATTCAAAACAAAGACGACAAAAGTGGAATGCGGCGGATGCTCAACG AAATGGGAGCTCATCACTTTTTCTACGATGCATGTGAACCACATTTTGAA GTTTTTCAAGACAGTCTCCTAGAATCAATGAAGCTTGTATTAAATGGTGG TGACTCGTTGGATGATGATATTGAGCAATCTTGGATTTGTgtgagtgaaa agtttggagaacactttgaaatttaaagtgctgttgtgatcatcggagag cattttttctatattgtattacatcatgctagaaaatcataataaaacac tccaaacacttttcagacttgtcaaaaatttcagtcaaagttttggcaaa ttgccgaattttccaaaaatgtagactatctgagtaatttttatcatagg gtttaacgcctacaaaattgaaaaaaaaaatcataaaaaattttctgaaa agtcttactggcatatttggtcattttagcactatcggggcaattttaag catttatcccgctgacgacactcactttcaataggtctagaaatttaaac tggaaaaatttcaacaaataagtaactaaaaataataagataacgattta gccaacgtgttttacatggttcaattaattttaacttttctgatgttaac tttttttaaactgaaagggtattgactttttaaaactaaactttttgcgc agaacattttatacttggaaaatttctagacatcattgcgcatccctcca ggcagctttgaatatgataattcaaaacaaagacgacaaaagtggaatgc ggcggatgctcaacgaaatgggagctcatcactttttctacgatgcatgt gaaccacattttgaagtttttcaagacagtctcctagaatcaatgaagct tgtattaaatggtggtgactcgttggatgatgatattgagcaatcttgga tttgtgtgagtgaaaagtttggagaacactttgaaatttaaagtgctgtt gtgatttcaaaaaacggtacttttaatttgaattacatgaagaacagact acttgtactaccaaaaaataaatttccataacttttcgaattgcagctgc TCCAAACAATCCGACTACATATGGGAGAAGGAATCGAAATTCAAAGAGCC AACTATCTAACGCAATGCTTGATTCCAAAAGAAATGGAAGAAGTACGTGC GAATTGGATGCAAGTCGAAAATTACGGGTTTCGAAAAGCCGGGCTTTTAT c Copy 1 Copy 2 N Supplementary Figure 3 The glb-5(bri) allele generates several mrna products a-c. RT-PCR analysis of glb-5 from N2 identifies multiple alternately spliced cdna products (a-c), whereas the glb-5(haw) allele generates one major product, corresponding to (c). Different exons are given different colours for clarity. Transcripts in (a) and (b) introduce premature stop codons into the glb-5 open reading frame. In (b), arrows point to the start of each copy of the glb-5(bri) duplication; the arrowhead marks splicing to an exon in the duplication, which results in a premature stop (underlined). 3
4 a A B C glb RIVDDDFELARTHWIQLQKSNKQGLAIRGCFLTML-EKYPQVR 42 Rice nshb SFSEEQEALVLKSWAILKKDSANIALRFFLKIFE---VAPSAS 52 neuroglobin MERPEPELIRQSWRAVSRSPLEHGTVLFARLFA---LEPDLL 39 cytoglobin ELSEAERKAVQATWARLYANCEDVGVAILVRFFV---NFPSAK 57 D.melanogaster Hb MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFN---RFPSNL 39 SwMb VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFK---SHPETL 41 C D E glb-5 PIWGF -GKRIEGRGDETWKPEIVEDFYFRHHCASLQAALNMIIQN----KDDKSGMRRM 94 Rice nshb QM -FSFLRNSD-VPLEKN PKLKTHAMSVFVMTCEA-AAQLRKAGKVTVRDTT 100 neuroglobin PL--FQYNCRQFSSPEDCL-----SSPEFLDHIRKVMLVIDAA----VTNVEDLSSLEEY 86 cytoglobin QY -FSQFRHME-DPLEME-----RSPQLRKHACRVMGALNTV----VENLHDPDKVSSV 103 D.melanogaster Hb EK--FPFRDVP -LEELSG------NARFRAHAGRIIRVFDES---IQVLGQDGDLEKLD 86 SwMb EK -FDRFKHLK-TEAEMK-----ASEDLKKHGVTVLTALGAI LKKKGHHEAE 88 F G H glb-5 LNEMGAHHFFYDACEPHFEVFQDSLLESMKLVLNGGDSLDDDIEQSWICLLQTIRLHM 146 Rice nshb LKRLGATHLKY-GVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAI 152 neuroglobin LASLGRKHRAVGVKLSSFSTVGESLLYMLEKCL-GPAFT-PATRAAWSQYGAVVQAMS 138 cytoglobin LALVGKAHALKHKVEPMYFKILSGVILEVIAEEFA-ND-FPVETQKAWAKLRGLIYSH 160 D.melanogaster Hb EIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAA--CSLD-ESQAATWAKLVDHVYGIIF 140 SwMb --LKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH-PGDFGADAQGAMNKALELFRKDI 141 H glb Rice nshb KQEMKPAE neuroglobin RGWDGE cytoglobin VTAAYKE--VGWVQQVPNTTTPPATLPSSGP 190 D.melanogaster Hb KAIDDDGNAK SwMb AAKYKEL-----GYQG b Supplementary Figure 4. Alignment of the glb-5 globin domain with other globins and best-fit structural prediction. a. Alignment of the glb-5 globin domain with non-symbiotic plant hemoglobin from rice (PDB ID: 1D8U), neuroglobin (H. sapiens), cytoglobin (M. musculus), globin 1 (D. melanogaster), and myoglobin (sperm whale, P. catodon) using the ClustalW2 program. Above the sequences are indicated predicted helices. Conserved residues are in gray. b. Model of the structure of the GLB-5 globin domain. The 3D-Pssm and Phyre programs 8 were used to find proteins with a similar fold. The best match was the rice non-symbiotic hemoglobin. This was used as a template to generate a 3D model of the glb-5 globin domain in the SWISS-MODEL program 9. The model generated is aligned with the 1D8U (rice) to highlight the hexacoordinated heme. The rice globin is colored in green and glb-5 in magenta. 4
5 a b kda ** * c His 6 - GLB-5 Ferric Ferrous Absorbance Wavelength (nm) Supplementary Figure 5. GLB-5 biochemistry a. GLB-5 tagged with maltose binding protein expressed and purified from E. coli is a soluble red-brown protein. b. Recombinant His-tagged GLB-5 expressed and purified from E. coli and run on an analytical SDS-PAGE gel. The single asterisk marks the predicted monomer and the double asterisk potential multimers of GLB-5. c. Oxidized and reduced GLB-5 protein exhibits absorbance spectra characteristic of hexa-coordinated globins. Spectra in the visible range showing the characteristic twin peaks of a hexa-coordinated globin. The recombinant protein shown is N-terminally His-tagged GLB-5. Although this protein localized to E. coli inclusion bodies it could be refolded in vitro with hemin. Its spectral properties were similar to those of MBPtagged GLB-5, which could be expressed as a soluble protein in E. coli (see Figure 2). 5
6 O 2 Concentration (%) Time (seconds) Supplementary Figure 6. Rapid oxygen switches in the microfluidic device. The time taken to switch from 7% to 21% O 2 in the microfluidic device under our recording conditions was less than 3 seconds. Measurements were made using a small optode sensor spot (PreSens, GmBH) placed in the agar under the device. 6
7 a % O 2 Speed (μm/s) % O 2 b 0 CB4856 BW288 PS1185 PS1186 VT847 EM464 PB227 PB228 PB229 SB129 PS1010 RGD1 RGD2 JU727 Cel Cbri Crem Cbre Csp3 Cspn Vancouver (1) Oregon (4) (1) Madison (1) (1) (9) (4) Hawaii (1) California Madeira (1) England (2) (1) France (42) Germany (22) glb-5 (Haw);npr-1 215F glb-5 (Bri);npr-1 215F glb-5 (Haw);npr-1 215V glb-5 (Bri);npr-1 215V Kenya(2) South Africa (2) Adelaide (3) Supplementary Figure 7. Distribution of glb-5 and npr-1 alleles in different C. elegans and Caenorhabditis sp isolates. a. Wild isolates from other Caenorhabditis species also reduce their locomotory activity in response to slight declines in ambient O 2 close to 21%. Cel, C. elegans; Cbri, C. briggsae; Crem, C. remanei; Cbre, C. brenneri; Csp3, Caenorhabditis species 3; Cspn, unnamed Caenorhabditis species. b. World map showing occurrence of different allelic combinations of npr-1 and glb-5 in 98 wild isolates of C. elegans. 7
8 Supplementary Table 1 npr-1 and glb-5 alleles in C. elegans wild strains Strain Area of origin Country Phenotype npr-1 glb-5 AB1 Adelaide Australia Social 215F unduplicated AB2 Adelaide Australia Social 215F unduplicated AB3 Adelaide Australia Social 215F unduplicated CB3196 Altadena California Social 215F unduplicated CB3197 Altadena California Social 215F unduplicated CB3198 Pasadena California Social 215F unduplicated CB3199 Pasadena California Social 215F unduplicated CB4852 Taunton England Social 215F unduplicated CB4853 Altadena California Social 215F unduplicated CB4854 Altadena California Social 215F unduplicated CB4855 Palo Alto California Social 215F unduplicated CB4856 Hawaii Hawaii Social 215F unduplicated CB4857 Claremont California Social 215F unduplicated CB4858 Pasadena California Social 215F unduplicated CB4932 Taunton England Social 215F unduplicated ED3040 Johannesberg S. Africa Social 215F unduplicated ED3049 Ceres S. Africa Social 215F unduplicated ED3054 Limuru Kenya Social 215F unduplicated ED3077 Nairobi Kenya Social 215F unduplicated JU258 Ribeiro Frio Madeira Social 215F unduplicated JU262 Le Blanc France Social 215F unduplicated JU263 Le Blanc France Social 215F unduplicated JU299 Le Blanc France Social 215F unduplicated JU300 Le Blanc France Social 215F unduplicated JU301 Le Blanc France Social 215F unduplicated JU302 Le Blanc France Social 215F unduplicated JU303 Le Blanc France Social 215F unduplicated JU304 Le Blanc France Social 215F unduplicated JU305 Le Blanc France Social 215F unduplicated JU306 Le Blanc France Social 215F unduplicated JU307 Le Blanc France Social 215F unduplicated JU308 Le Blanc France Social 215F unduplicated JU309 Le Blanc France Social 215F unduplicated JU310 Le Blanc France Social 215F unduplicated JU312 Merlet France Social 215F unduplicated JU314 Merlet France Social 215F unduplicated JU315 Merlet France Social 215F unduplicated JU316 Merlet France Social 215F unduplicated JU317 Merlet France Social 215F unduplicated JU318 Merlet France Social 215F unduplicated JU319 Merlet France Social 215F unduplicated JU320 Merlet France Social 215F unduplicated JU321 Merlet France Social 215F unduplicated JU322 Merlet France Social 215F unduplicated JU323 Merlet France Social 215F unduplicated JU342 Merlet France Social 215F unduplicated JU343 Merlet France Social 215F unduplicated JU344 Merlet France Social 215F unduplicated JU345 Merlet France Social 215F unduplicated JU346 Merlet France Social 215F unduplicated JU347 Merlet France Social 215F unduplicated JU362 Franconville France Social 215F unduplicated JU365 Franconville France Social 215F unduplicated JU366 Franconville France Social 215F unduplicated JU367 Franconville France Social 215F unduplicated JU368 Franconville France Social 215F unduplicated JU369 Franconville France Social 215F unduplicated 8
9 JU370 Franconville France Social 215F unduplicated JU371 Franconville France Social 215F unduplicated JU401 Hermanville France Social 215F unduplicated JU406 Hermanville France Social 215F unduplicated KR314 Vancouver Canada Social 215F unduplicated MY19 Roxel Germany Social 215F unduplicated MY1 Lingen Germany Social 215F unduplicated MY10 Roxel Germany Social 215F unduplicated MY11 Roxel Germany Social 215F unduplicated MY12 Roxel Germany Social 215F unduplicated MY13 Roxel Germany Social 215F unduplicated MY16 Mecklenberg Germany Social 215F unpdulicated MY17 Roxel Germany Social 215F unduplicated MY18 Roxel Germany Social 215F unduplicated MY2 Roxel Germany Social 215F unduplicated MY20 Roxel Germany Social 215F unduplicated MY21 Roxel Germany Social 215F unduplicated MY22 Roxel Germany Social 215F unduplicated MY23 Roxel Germany Social 215F unduplicated MY3 Roxel Germany Social 215F unduplicated MY4 Roxel Germany Social 215F unduplicated MY5 Roxel Germany Social 215F unduplicated MY6 Roxel Germany Social 215F unduplicated MY7 Roxel Germany Social 215F unduplicated MY8 Roxel Germany Social 215F unduplicated MY9 Roxel Germany Social 215F unduplicated PB303 n/a Oregon Social 215F unduplicated PB306 n/a Oregon Social 215F unduplicated PX174 Devil's Lake Oregon Social 215F unduplicated PX178 Eugene Oregon Social 215F unduplicated PX179 Eugene Germany Social 215F unduplicated RC301 Freiburg France Social 215F unduplicated CB3191 Altadena California Solitary 215V duplicated CB4507 Palm Canyon California Solitary 215V duplicated CB4555 Palo Alto California Solitary 215V duplicated DH424 El Prieto California Solitary 215V duplicated N2 Bristol England Solitary 215V duplicated PX176 Eugene Oregon Solitary 215V duplicated TR389 Madison Wisconsin Solitary 215V unduplicated TR403 Madison Wisconsin Solitary 215V duplicated 9
10 Supplementary Table 2. SNPs in the glb-5 interval Name Position Alters CB N2 CB4932 JU263 JU345 MY1 RC301 hw intron 1 T C C C C C C hw intron 1 T C C C C C C hw intron 1 T G G G G G G hw intron 1 G T T T T T T hw intron 1 T C C C C C C intron 1 - A A A A A A hw intron 1 T A A A A A A hw intron 1 C A A A A A A C18C4(8) intron 1 A T T T T T T hw intron 2 A T T T T T T Supplementary Table 3. The unduplicated glb-5 allele is likely to be the ancestral form of this gene. Genotype Genotype Species Strain npr-1 glb-5 C. brenneri CB F Unduplicated C. briggsae AF16 215F Unduplicated C. remanei EM F Unduplicated 10
tgg agg Supplementary Figure S1.
ttaggatattcggtgaggtgatatgtctctgtttggaaatgtctccgccattaactcaag tggaaagtgtatagtaatgaatctttcaagcacacagatcacttcaaaagactgtttcaa catcacctcaggacaaaaagatgtactctcatttggatgctgtgatgccatgggtcacag attgcaattcccaagtgcccgttcttttacaccaaaatcaaagaagaatatctccccttt
Experimental Identification and Computational Characterization of a Novel. Extracellular Metalloproteinase Produced by Clostridium sordellii
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 207 Supplementary Information Experimental Identification and Computational Characterization of
FETAL FIBROBLASTS, PASSAGE 10
Double-stranded methylation patterns of a 104-bp L1 promoter in DNAs from fetal fibroblast passages 10, 14, 17, and 22 using barcoded hairpinbisulfite PCR. Fifteen L1 sequences were analyzed for passages
Methods S1. Sequences relevant to the constructed strains, Related to Figures 1-6.
Methods S1. Sequences relevant to the constructed strains, Related to Figures 1-6. A. Promoter Sequences Gal4 binding sites are highlighted in the color referenced in Figure 1A when possible. Site 1: red,
Capacity Utilization
Capacity Utilization Tim Schöneberg 28th November Agenda Introduction Fixed and variable input ressources Technical capacity utilization Price based capacity utilization measure Long run and short run
7.4 Variability management
7.4 Variability management time... space software product-line should support variability in space (different products) support variability in time (maintenance, evolution) 1 Product variation Product
Supporting information
Supporting information Figure S1. Carotenoid biosynthesis pathway in papaya fruit which is adopted from Blas et al. (2010) (reference 4) and Nisar et al. (2015) (reference 5). Carotenoids are synthesized
Supporting Information for
Supporting Information for Analysis of Sogatella furcifera proteome that interact with P10 protein of Southern rice black-streaked dwarf virus Win Than*, Faliang Qin*, Wenwen Liu, Xifeng Wang ** State
MALE ADULT FIBROBLAST LINE (82-6hTERT)
Double-stranded methylation patterns of a 104-bp L1 promoter in DNAs from male and female fibroblasts, male leukocytes and female lymphoblastoid cells using hairpin-bisulfite PCR. Fifteen L1 sequences
Plasmid Name: pmm290. Aliases: none known. Length: bp. Constructed by: Mike Moser/Cristina Swanson. Last updated: 17 August 2009
Plasmid Name: pmm290 Aliases: none known Length: 11707 bp Constructed by: Mike Moser/Cristina Swanson Last updated: 17 August 2009 Description and application: This is a mammalian expression vector for
16. Allocation Models
16. Allocation Models Juha Saloheimo 17.1.27 S steemianalsin Optimointiopin seminaari - Sks 27 Content Introduction Overall Efficienc with common prices and costs Cost Efficienc S steemianalsin Revenue
Efficiency change over time
Efficiency change over time Heikki Tikanmäki Optimointiopin seminaari 14.11.2007 Contents Introduction (11.1) Window analysis (11.2) Example, application, analysis Malmquist index (11.3) Dealing with panel
Supplementary information: Biocatalysis on the surface of Escherichia coli: melanin pigmentation of the cell. exterior
Supplementary information: Biocatalysis on the surface of Escherichia coli: melanin pigmentation of the cell exterior Martin Gustavsson, David Hörnström, Susanna Lundh, Jaroslav Belotserkovsky, Gen Larsson
Functional Genomics & Proteomics
Functional Genomics & Proteomics Genome Sequences TCACAATTTAGACATCTAGTCTTCCACTTAAGCATATTTAGATTGTTTCCAGTTTTCAGCTTTTATGACTAAATCTTCTAAAATTGTTTTTCCCTAAATGTATATTTTAATTTGTCTCAGGAGTAGAATTTCTGAGTCATAAAGCGGT CATATGTATAAATTTTAGGTGCCTCATAGCTCTTCAAATAGTCATCCCATTTTATACATCCAGGCAATATATGAGAGTTCTTGGTGCTCCACATCTTAGCTAGGATTTGATGTCAACCAGTCTCTTTAATTTAGATATTCTAGTACAT
On instrument costs in decentralized macroeconomic decision making (Helsingin Kauppakorkeakoulun julkaisuja ; D-31)
On instrument costs in decentralized macroeconomic decision making (Helsingin Kauppakorkeakoulun julkaisuja ; D-31) Juha Kahkonen Click here if your download doesn"t start automatically On instrument costs
Other approaches to restrict multipliers
Other approaches to restrict multipliers Heikki Tikanmäki Optimointiopin seminaari 10.10.2007 Contents Short revision (6.2) Another Assurance Region Model (6.3) Cone-Ratio Method (6.4) An Application of
Results on the new polydrug use questions in the Finnish TDI data
Results on the new polydrug use questions in the Finnish TDI data Multi-drug use, polydrug use and problematic polydrug use Martta Forsell, Finnish Focal Point 28/09/2015 Martta Forsell 1 28/09/2015 Esityksen
National Building Code of Finland, Part D1, Building Water Supply and Sewerage Systems, Regulations and guidelines 2007
National Building Code of Finland, Part D1, Building Water Supply and Sewerage Systems, Regulations and guidelines 2007 Chapter 2.4 Jukka Räisä 1 WATER PIPES PLACEMENT 2.4.1 Regulation Water pipe and its
1. SIT. The handler and dog stop with the dog sitting at heel. When the dog is sitting, the handler cues the dog to heel forward.
START START SIT 1. SIT. The handler and dog stop with the dog sitting at heel. When the dog is sitting, the handler cues the dog to heel forward. This is a static exercise. SIT STAND 2. SIT STAND. The
FinFamily PostgreSQL installation ( ) FinFamily PostgreSQL
FinFamily PostgreSQL 1 Sisällys / Contents FinFamily PostgreSQL... 1 1. Asenna PostgreSQL tietokanta / Install PostgreSQL database... 3 1.1. PostgreSQL tietokannasta / About the PostgreSQL database...
Network to Get Work. Tehtäviä opiskelijoille Assignments for students. www.laurea.fi
Network to Get Work Tehtäviä opiskelijoille Assignments for students www.laurea.fi Ohje henkilöstölle Instructions for Staff Seuraavassa on esitetty joukko tehtäviä, joista voit valita opiskelijaryhmällesi
State of the Union... Functional Genomics Research Stream. Molecular Biology. Genomics. Computational Biology
Functional Genomics Research Stream State of the Union... Research Meeting: February 16, 2010 Functional Genomics & Research Report III Concepts Genomics Molecular Biology Computational Biology Genome
Metsälamminkankaan tuulivoimapuiston osayleiskaava
VAALAN KUNTA TUULISAIMAA OY Metsälamminkankaan tuulivoimapuiston osayleiskaava Liite 3. Varjostusmallinnus FCG SUUNNITTELU JA TEKNIIKKA OY 12.5.2015 P25370 SHADOW - Main Result Assumptions for shadow calculations
The CCR Model and Production Correspondence
The CCR Model and Production Correspondence Tim Schöneberg The 19th of September Agenda Introduction Definitions Production Possiblity Set CCR Model and the Dual Problem Input excesses and output shortfalls
Returns to Scale II. S ysteemianalyysin. Laboratorio. Esitelmä 8 Timo Salminen. Teknillinen korkeakoulu
Returns to Scale II Contents Most Productive Scale Size Further Considerations Relaxation of the Convexity Condition Useful Reminder Theorem 5.5 A DMU found to be efficient with a CCR model will also be
Plasmid construction PCR reactions were carried out with Pfu or Pfu turbo polymerases (Stratagene) unless otherwise stated.
Expanding the Genetic Code of Yeast for Incorporation of Diverse Unnatural Amino Acids via a Pyrrolysyl-tRNA Synthetase/tRNA Pair Susan M. Hancock 1, Rajendra Uprety 2, Alexander Deiters 2 & Jason W. Chin
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table WindPRO version 2.9.269
On instrument costs in decentralized macroeconomic decision making (Helsingin Kauppakorkeakoulun julkaisuja ; D-31)
On instrument costs in decentralized macroeconomic decision making (Helsingin Kauppakorkeakoulun julkaisuja ; D-31) Juha Kahkonen Click here if your download doesn"t start automatically On instrument costs
LYTH-CONS CONSISTENCY TRANSMITTER
LYTH-CONS CONSISTENCY TRANSMITTER LYTH-INSTRUMENT OY has generate new consistency transmitter with blade-system to meet high technical requirements in Pulp&Paper industries. Insurmountable advantages are
( ( OX2 Perkkiö. Rakennuskanta. Varjostus. 9 x N131 x HH145
OX2 9 x N131 x HH145 Rakennuskanta Asuinrakennus Lomarakennus Liike- tai julkinen rakennus Teollinen rakennus Kirkko tai kirkollinen rak. Muu rakennus Allas Varjostus 1 h/a 8 h/a 20 h/a 0 0,5 1 1,5 2 km
Alternative DEA Models
Mat-2.4142 Alternative DEA Models 19.9.2007 Table of Contents Banker-Charnes-Cooper Model Additive Model Example Data Home assignment BCC Model (Banker-Charnes-Cooper) production frontiers spanned by convex
Tynnyrivaara, OX2 Tuulivoimahanke. ( Layout 9 x N131 x HH145. Rakennukset Asuinrakennus Lomarakennus 9 x N131 x HH145 Varjostus 1 h/a 8 h/a 20 h/a
, Tuulivoimahanke Layout 9 x N131 x HH145 Rakennukset Asuinrakennus Lomarakennus 9 x N131 x HH145 Varjostus 1 h/a 8 h/a 20 h/a 0 0,5 1 1,5 km 2 SHADOW - Main Result Assumptions for shadow calculations
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table WindPRO version 2.8.579
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table WindPRO version 2.8.579
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table WindPRO version 2.8.579
TM ETRS-TM35FIN-ETRS89 WTG
VE1 SHADOW - Main Result Calculation: 8 x Nordex N131 x HH145m Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table WindPRO version 2.8.579
toukokuu 2011: Lukion kokeiden kehittämistyöryhmien suunnittelukokous
Tuula Sutela toukokuu 2011: Lukion kokeiden kehittämistyöryhmien suunnittelukokous äidinkieli ja kirjallisuus, modersmål och litteratur, kemia, maantiede, matematiikka, englanti käsikirjoitukset vuoden
Choose Finland-Helsinki Valitse Finland-Helsinki
Write down the Temporary Application ID. If you do not manage to complete the form you can continue where you stopped with this ID no. Muista Temporary Application ID. Jos et onnistu täyttää lomake loppuun
Viral DNA as a model for coil to globule transition
Viral DNA as a model for coil to globule transition Marina Rossi Lab. of complex fluids and molecular biophysics LITA (Segrate) UNIVERSITA DEGLI STUDI DI MILANO - PhD Workshop October 14 th, 2013 Temperature
WindPRO version joulu 2012 Printed/Page :42 / 1. SHADOW - Main Result
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table 13.6.2013 19:42 / 1 Minimum
LX 70. Ominaisuuksien mittaustulokset 1-kerroksinen 2-kerroksinen. Fyysiset ominaisuudet, nimellisarvot. Kalvon ominaisuudet
LX 70 % Läpäisy 36 32 % Absorptio 30 40 % Heijastus 34 28 % Läpäisy 72 65 % Heijastus ulkopuoli 9 16 % Heijastus sisäpuoli 9 13 Emissiivisyys.77.77 Auringonsuojakerroin.54.58 Auringonsäteilyn lämmönsiirtokerroin.47.50
Use of spatial data in the new production environment and in a data warehouse
Use of spatial data in the new production environment and in a data warehouse Nordic Forum for Geostatistics 2007 Session 3, GI infrastructure and use of spatial database Statistics Finland, Population
WindPRO version joulu 2012 Printed/Page :47 / 1. SHADOW - Main Result
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table WindPRO version 2.8.579
anna minun kertoa let me tell you
anna minun kertoa let me tell you anna minun kertoa I OSA 1. Anna minun kertoa sinulle mitä oli. Tiedän että osaan. Kykenen siihen. Teen nyt niin. Minulla on oikeus. Sanani voivat olla puutteellisia mutta
( ,5 1 1,5 2 km
Tuulivoimala Rakennukset Asuinrakennus Liikerak. tai Julkinen rak. Lomarakennus Teollinen rakennus Kirkollinen rakennus Varjostus "real case" h/a 1 h/a 8 h/a 20 h/a 4 5 3 1 2 6 7 8 9 10 0 0,5 1 1,5 2 km
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table 22.12.2014 11:33 / 1 Minimum
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Calculation: N117 x 9 x HH141 Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG
,0 Yes ,0 120, ,8
SHADOW - Main Result Calculation: Alue 2 ( x 9 x HH120) TuuliSaimaa kaavaluonnos Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered
Exercise 1. (session: )
EEN-E3001, FUNDAMENTALS IN INDUSTRIAL ENERGY ENGINEERING Exercise 1 (session: 24.1.2017) Problem 3 will be graded. The deadline for the return is on 31.1. at 12:00 am (before the exercise session). You
CS284A Representations & Algorithms for Molecular Biology. Xiaohui S. Xie University of California, Irvine
CS284A Representations & Algorithms for Molecular Biology Xiaohui S. Xie University of California, Irvine Today s Goals Course information Challenges in computational biology Introduction to molecular
KMTK lentoestetyöpaja - Osa 2
KMTK lentoestetyöpaja - Osa 2 Veijo Pätynen 18.10.2016 Pasila YHTEISTYÖSSÄ: Ilmailun paikkatiedon hallintamalli Ilmailun paikkatiedon hallintamalli (v0.9 4.3.2016) 4.4 Maanmittauslaitoksen rooli ja vastuut...
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table 5.11.2013 16:44 / 1 Minimum
7. Product-line architectures
7. Product-line architectures 7.1 Introduction 7.2 Product-line basics 7.3 Layered style for product-lines 7.4 Variability management 7.5 Benefits and problems with product-lines 1 Short history of software
Lataa SETI Revisited - Risto Isomäki. Lataa
Lataa SETI Revisited - Risto Isomäki Lataa Kirjailija: Risto Isomäki ISBN: 9789522648457 Sivumäärä: 100 Formaatti: PDF Tiedoston koko: 20.51 Mb In his newest book Risto Isomäki argues that instead of only
You can check above like this: Start->Control Panel->Programs->find if Microsoft Lync or Microsoft Lync Attendeed is listed
Online Meeting Guest Online Meeting for Guest Participant Lync Attendee Installation Online kokous vierailevalle osallistujalle Lync Attendee Asennus www.ruukki.com Overview Before you can join to Ruukki
Ajettavat luokat: SM: S1 (25 aika-ajon nopeinta)
SUPERMOTO SM 2013 OULU Lisämääräys ja ohje Oulun Moottorikerho ry ja Oulun Formula K-125ry toivottaa SuperMoto kuljettajat osallistumaan SuperMoto SM 2013 Oulu osakilpailuun. Kilpailu ajetaan karting radalla
Underpinning Phage Arbitrium Communication Systems
Molecular Cell, Volume 74 Supplemental Information Deciphering the Molecular Mechanism Underpinning Phage Arbitrium Communication Systems Francisca Gallego del Sol, José R. Penadés, and Alberto Marina
Characterization of clay using x-ray and neutron scattering at the University of Helsinki and ILL
Characterization of clay using x-ray and neutron scattering at the University of Helsinki and ILL Ville Liljeström, Micha Matusewicz, Kari Pirkkalainen, Jussi-Petteri Suuronen and Ritva Serimaa 13.3.2012
Constructive Alignment in Specialisation Studies in Industrial Pharmacy in Finland
Constructive Alignment in Specialisation Studies in Industrial Pharmacy in Finland Anne Mari Juppo, Nina Katajavuori University of Helsinki Faculty of Pharmacy 23.7.2012 1 Background Pedagogic research
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table WindPRO version 2.8.579
Basset: Learning the regulatory code of the accessible genome with deep convolutional neural networks. David R. Kelley
Basset: Learning the regulatory code of the accessible genome with deep convolutional neural networks David R. Kelley DNA codes for complex life. How? Kundaje et al. Integrative analysis of 111 reference
4x4cup Rastikuvien tulkinta
4x4cup Rastikuvien tulkinta 4x4cup Control point picture guidelines Päivitetty kauden 2010 sääntöihin Updated for 2010 rules Säännöt rastikuvista Kilpailijoiden tulee kiinnittää erityistä huomiota siihen,
Genome 373: Genomic Informatics. Professors Elhanan Borenstein and Jay Shendure
Genome 373: Genomic Informatics Professors Elhanan Borenstein and Jay Shendure Genome 373 This course is intended to introduce students to the breadth of problems and methods in computational analysis
Digital Admap Native. Campaign: Kesko supermarket
Digital Admap Native Campaign: Kesko supermarket Digital Admap Native Campaign: Kesko Supermarket Mainosmuoto: Natiivi Media: IS.fi Campaign period: 25 September Date of measurement: 26 September Unique:
FIS IMATRAN KYLPYLÄHIIHDOT Team captains meeting
FIS IMATRAN KYLPYLÄHIIHDOT 8.-9.12.2018 Team captains meeting 8.12.2018 Agenda 1 Opening of the meeting 2 Presence 3 Organizer s personell 4 Jury 5 Weather forecast 6 Composition of competitors startlists
Strain or plasmid Description a Reference or source b. 168 trpc2 Laboratory. 1A780 trpc2 sigb::spc BGSC
TABLE S1 Bacterial strains and plasmids Strain or plasmid Description a Reference or source b B. subtilis 168 trpc2 Laboratory stock 1A780 trpc2 sigb::spc BGSC BM1010 trpc2 htpx::pgs1582; Em r BM1302 trpc2
KONEISTUSKOKOONPANON TEKEMINEN NX10-YMPÄRISTÖSSÄ
KONEISTUSKOKOONPANON TEKEMINEN NX10-YMPÄRISTÖSSÄ https://community.plm.automation.siemens.com/t5/tech-tips- Knowledge-Base-NX/How-to-simulate-any-G-code-file-in-NX- CAM/ta-p/3340 Koneistusympäristön määrittely
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table WindPRO version 2.8.579
TM ETRS-TM35FIN-ETRS89 WTG
SHADOW - Main Result Assumptions for shadow calculations Maximum distance for influence Calculate only when more than 20 % of sun is covered by the blade Please look in WTG table WindPRO version 2.8.579
VAASAN YLIOPISTO Humanististen tieteiden kandidaatin tutkinto / Filosofian maisterin tutkinto
VAASAN YLIOPISTO Humanististen tieteiden kandidaatin tutkinto / Filosofian maisterin tutkinto Tämän viestinnän, nykysuomen ja englannin kandidaattiohjelman valintakokeen avulla Arvioidaan viestintävalmiuksia,
Arkkitehtuuritietoisku. eli mitä aina olet halunnut tietää arkkitehtuureista, muttet ole uskaltanut kysyä
Arkkitehtuuritietoisku eli mitä aina olet halunnut tietää arkkitehtuureista, muttet ole uskaltanut kysyä Esikysymys Kuinka moni aikoo suunnitella projektityönsä arkkitehtuurin? Onko tämä arkkitehtuuria?
enzymatic families regulated in response to a short-term cytokinin treatment in root apices
A B C D Supplemental tlfigure 1. 1Mtbli Metabolic processes, hormonal pathways and dlarge enzymatic families regulated in response to a short-term cytokinin treatment in root apices The 297 transcripts
Basic Flute Technique
Herbert Lindholm Basic Flute Technique Peruskuviot huilulle op. 26 Helin & Sons, Helsinki Basic Flute Technique Foreword This book has the same goal as a teacher should have; to make himself unnecessary.
Miehittämätön meriliikenne
Rolls-Royce & Unmanned Shipping Ecosystem Miehittämätön meriliikenne Digimurros 2020+ 17.11. 2016 September 2016 2016 Rolls-Royce plc The 2016 information Rolls-Royce in this plc document is the property
Supplementary Material : Baker et al. 1
Supplementary Material : Baker et al. 1 Supplementary Material Title: Species identity and human consumption of beaked whales in the Gilbert Islands, Republic of Kiribati Authors: C. Scott Baker, Al Hutt,
Sisällysluettelo Table of contents
Sisällysluettelo Table of contents OTC:n Moodlen käyttöohje suomeksi... 1 Kirjautuminen Moodleen... 2 Ensimmäinen kirjautuminen Moodleen... 2 Salasanan vaihto... 2 Oma käyttäjäprofiili... 3 Työskentely
MEETING PEOPLE COMMUNICATIVE QUESTIONS
Tiistilän koulu English Grades 7-9 Heikki Raevaara MEETING PEOPLE COMMUNICATIVE QUESTIONS Meeting People Hello! Hi! Good morning! Good afternoon! How do you do? Nice to meet you. / Pleased to meet you.
Uusi Ajatus Löytyy Luonnosta 4 (käsikirja) (Finnish Edition)
Uusi Ajatus Löytyy Luonnosta 4 (käsikirja) (Finnish Edition) Esko Jalkanen Click here if your download doesn"t start automatically Uusi Ajatus Löytyy Luonnosta 4 (käsikirja) (Finnish Edition) Esko Jalkanen
Rakennukset Varjostus "real case" h/a 0,5 1,5
Tuulivoimala Rakennukset Asuinrakennus Liikerak. tai Julkinen rak. Lomarakennus Teollinen rakennus Kirkollinen rakennus Varjostus "real case" h/a 1 h/a 8 h/a 20 h/a 1 2 3 5 8 4 6 7 9 10 0 0,5 1 1,5 2 km
Mat Seminar on Optimization. Data Envelopment Analysis. Economies of Scope S ysteemianalyysin. Laboratorio. Teknillinen korkeakoulu
Mat-2.4142 Seminar on Optimization Data Envelopment Analysis Economies of Scope 21.11.2007 Economies of Scope Introduced 1982 by Panzar and Willing Support decisions like: Should a firm... Produce a variety
Tilausvahvistus. Anttolan Urheilijat HENNA-RIIKKA HAIKONEN KUMMANNIEMENTIE 5 B RAHULA. Anttolan Urheilijat
7.80.4 Asiakasnumero: 3000359 KALLE MANNINEN KOVASTENLUODONTIE 46 51600 HAUKIVUORI Toimitusosoite: KUMMANNIEMENTIE 5 B 51720 RAHULA Viitteenne: Henna-Riikka Haikonen Viitteemme: Pyry Niemi +358400874498
Bounds on non-surjective cellular automata
Bounds on non-surjective cellular automata Jarkko Kari Pascal Vanier Thomas Zeume University of Turku LIF Marseille Universität Hannover 27 august 2009 J. Kari, P. Vanier, T. Zeume (UTU) Bounds on non-surjective
Infrastruktuurin asemoituminen kansalliseen ja kansainväliseen kenttään Outi Ala-Honkola Tiedeasiantuntija
Infrastruktuurin asemoituminen kansalliseen ja kansainväliseen kenttään Outi Ala-Honkola Tiedeasiantuntija 1 Asemoitumisen kuvaus Hakemukset parantuneet viime vuodesta, mutta paneeli toivoi edelleen asemoitumisen
Business Opening. Arvoisa Herra Presidentti Very formal, recipient has a special title that must be used in place of their name
- Opening Finnish Norwegian Arvoisa Herra Presidentti Very formal, recipient has a special title that must be used in place of their name Hyvä Herra, Formal, male recipient, name unknown Hyvä Rouva Formal,
812336A C++ -kielen perusteet, 21.8.2010
812336A C++ -kielen perusteet, 21.8.2010 1. Vastaa lyhyesti seuraaviin kysymyksiin (1p kaikista): a) Mitä tarkoittaa funktion ylikuormittaminen (overloading)? b) Mitä tarkoittaa jäsenfunktion ylimääritys
Python Libraries 1 / 14
Python Libraries 1 / 14 Gzip, CSV https://docs.python.org/3/library/gzip.html https://docs.python.org/3/library/csv.html https://daler.github.io/pybedtools/ - PyBed tools http://biopython.org/wiki/gff_parsing
Travel Getting Around
- Location Olen eksyksissä. Not knowing where you are Voisitko näyttää kartalta missä sen on? Asking for a specific location on a map Mistä täällä on? Asking for a specific...wc?...pankki / rahanvaihtopiste?...hotelli?...huoltoasema?...sairaala?...apteekki?...tavaratalo?...ruokakauppa?...bussipysäkki?
3 9-VUOTIAIDEN LASTEN SUORIUTUMINEN BOSTONIN NIMENTÄTESTISTÄ
Puhe ja kieli, 27:4, 141 147 (2007) 3 9-VUOTIAIDEN LASTEN SUORIUTUMINEN BOSTONIN NIMENTÄTESTISTÄ Soile Loukusa, Oulun yliopisto, suomen kielen, informaatiotutkimuksen ja logopedian laitos & University
On instrument costs in decentralized macroeconomic decision making (Helsingin Kauppakorkeakoulun julkaisuja ; D-31)
On instrument costs in decentralized macroeconomic decision making (Helsingin Kauppakorkeakoulun julkaisuja ; D-31) Juha Kahkonen Click here if your download doesn"t start automatically On instrument costs
ReFuel 70 % Emission Reduction Using Renewable High Cetane Number Paraffinic Diesel Fuel. Kalle Lehto, Aalto-yliopisto 5.5.
ReFuel 70 % Emission Reduction Using Renewable High Cetane Number Paraffinic Diesel Fuel Kalle Lehto, Aalto-yliopisto 5.5.2011 Otaniemi ReFuel a three year research project (2009-2011) goal utilize the
T U O T T E E T P R O D U C T S
TUOTTEET PRODUCTS TUOTTEIDEN VÄRIMALLIT / AVAILABLE PRODUCT COLOURS SISÄLLYS TABLE OF CONTENTS MUSTA / BLACK VALKOINEN / WHITE HARMAA / GRAY LAMINAATIN VÄRIMALLIT / LAMINATE COLOURS VÄRITÖN / NATURAL TARINAMME
Supplementary Information
Supplementary Information Quantifying Absolute Addressability in DNA origami with Molecular Resolution Maximilian T. Strauss, Florian Schueder, Daniel Haas, Philipp C. Nickels, and Ralf Jungmann Supplementary
MUSEOT KULTTUURIPALVELUINA
Elina Arola MUSEOT KULTTUURIPALVELUINA Tutkimuskohteena Mikkelin museot Opinnäytetyö Kulttuuripalvelujen koulutusohjelma Marraskuu 2005 KUVAILULEHTI Opinnäytetyön päivämäärä 25.11.2005 Tekijä(t) Elina
T U O T T E E T P R O D U C T S
TUOTTEET PRODUCTS TUOTTEIDEN VÄRIMALLIT / AVAILABLE PRODUCT COLOURS SISÄLLYS TABLE OF CONTENTS TARINAMME / OUR STORY...4 SÄILYTINKALUSTEET / STORAGE FURNITURE...6 KAIKU...8 APILA... 10 VALO... 12 TUKKI...
make and make and make ThinkMath 2017
Adding quantities Lukumäärienup yhdistäminen. Laske yhteensä?. Countkuinka howmonta manypalloja ballson there are altogether. and ja make and make and ja make on and ja make ThinkMath 7 on ja on on Vaihdannaisuus
Curriculum. Gym card
A new school year Curriculum Fast Track Final Grading Gym card TET A new school year Work Ethic Detention Own work Organisation and independence Wilma TMU Support Services Well-Being CURRICULUM FAST TRACK
Garden Furniture. Puutarhakalusteita
Garden Furniture Puutarhakalusteita Painekyllästetyt Impregnated PEFC/02-31-113 Pepe-puutarhakalusteet ovat lähes 40 vuoden ajan ilahduttaneet asiakkaita niin Suomessa kuin ympäri Eurooppaakin, päämarkkina-alueina
WAMS 2010,Ylivieska Monitoring service of energy efficiency in housing. 13.10.2010 Jan Nyman, jan.nyman@posintra.fi
WAMS 2010,Ylivieska Monitoring service of energy efficiency in housing 13.10.2010 Jan Nyman, jan.nyman@posintra.fi Background info STOK: development center for technology related to building automation
Eukaryotic Comparative Genomics
Eukaryotic Comparative Genomics Detecting Conserved Sequences Charles Darwin Motoo Kimura Evolution of Neutral DNA A A T C TA AT T G CT G T GA T T C A GA G T A G CA G T GA AT A GT C T T T GA T GT T G T