Laskuharjoitus 2 vastauksia ja selityksiä

Koko: px
Aloita esitys sivulta:

Download "Laskuharjoitus 2 vastauksia ja selityksiä"

Transkriptio

1 Laskuharjoitus vastauksia ja selityksiä Selitykset ovat usein jonkin verran laajempia kuin vastaukseen edellytetyt, jotta asia selviäisi niillekin, jotka eivät sitä aluksi olleet keksineet. Tehtävä : Proteiinien ja hiilihydraattien perusasioita 0 8 p. A. Primäärirakenteesta ja muusta a) Kuinka monta erilaista 00 aminohapon polypeptidiketjua voidaan rakentaa 0 erilaisesta aminohaposta? Millaiset translaation jälkeiset modifikaatiot lisäävät entisestään mahdollisten erilaisten muotojen määrää? Koska peptidiketjulla on suunta eli aminohappo ei voi esiintyä ketjussa kumpaan suuntaan hyvänsä, on mahdollisuuksia 0 00, b) Jos geenissä on viisi eksonia, joista kukin koodaa n. 00 aminohapon kokoista domeenia, niin mitä mahdollisuuksia tuottaa geenistä erilaisia proteiineja edellisen kohdan vaihtelun lisäksi? Lisävaihtelua tuottaa se, että eksoneista vain osa voidaan lukea proteiiniksi. Proteiinia koodaava mrna voi siis olla yhdistelmä eri eksoneista ja näin ollen proteiinia voi sisältää eri domeeneja. c) Hiilihydraattikoodissa lisävariaatiota tuo mahdollisuus muodostaa erilaisia sidoksia eri monosakkaridien välillä ja näin ollen mahdollisuus tehdä haarautuneita ketjuja. Lasketaan yksinkertaistettu havainnollistava lasku. Ajattele, että sinulla on käytössäsi viittä erilaista molekyylejä, jotka voivat sitoutua toisiinsa neljän molekyylin molekyylin pituiseksi lineaariseksi ketjuksi, joka on toisesta päästään kiinnittynyt johonkin partikkeliin ja jossa molekyyleillä on suunta muodostaa sidoksia kolmella avaruudellisesti erilaisella ryhmällä (sidokset -, -, -, -, -, -, -, - ja - mahdollisia kahden molekyylin välillä) ja muodostaa näin ollen paitsi lineaarisia myös haaroittuneita ketjuja, jotka ovat samaten neljän molekyylin mittaisia ja yhdestä päästään kiinni jossakin partikkelissa. Kuinka monta erilaista lineaarista ketjua voit muodostaa tilanteissa ja? Kuinka monta ketjua voit kaikkiaan muodostaa tilanteessa, kun otat haaroittuneetkin huomioon? Hahmottele pieni joukko samasta monomeeristä rakentuvia, partikkeliin kiinnittyviä, mahdollisia ketjuja tilanteessa. Tilanne on samanlainen kuin olisi tapaus, jossa on vain viisi erilaista aminohappoa. Mahdollisuuksia on siis 5 4 =65. Tilanteessa on lineaarisia eli haarattomia ketjuja olemassa suurempi määrä. Ensimmäiseen alustaan sidottuun voi seuraava sitoutua kahdella eri tavalla. Samoin sitä seuraavaan jne.

2 Näin ollen on eri muotoisia haarautumattomia ketjuja **=8. Lisäksi jokainen palikka voi olla kolmessa eri asennossa ja palikoita on viittä erilaista, joten yhteensä mahdollisuuksia on 8* 4 *5 4 = Kun otetaan lisäksi huomioon haarautuneet, vaihtoehtojen määrä kasvaa entisestään. Yllä olevasta kuvasta nähdään, että kahdeksan eri muotoisen lineaarisen ketjun lisäksi on kaksi sellaista eri muotoista haarautunutta ketjua, joissa kaikki lähtevät ensimmäisestä palikasta joko vasemmalle tai oikealle eli sellaista, joissa alustaan kiinnittyneeseen palikkaan on kiinnittynyt suoraan vain yksi palikka. Lisäksi nähdään, että on sekä vasemmalle että oikealle kiinnityttäessä kaksi eri muotoista ketjua (sininen vaihtoehto ja punainen vaihtoehto) eli yhteensä neljä vaihtoehtoa, jos ensimmäiseen palikkaan kiinnittyy suoraan kaksi palikkaa. Näin ollen eri muotoisia ketjuja on yhteensä 8++4=4. Samoin kuin edellä saadaan erilaisten ketjujen kokonaismääräksi 4* 4 *5 4 = d) Minkä sokereiden biologisen tehtävän kannalta c-kohdassa havainnollistettu seikka on mitä ilmeisimmin hyödyllinen? Sokerit toimivat monissa kudoksissa ja solujen välisissä vuorovaikutuksissa tunnistesignaaleina. Toisessa tunnistuksen osapuolessa on tunnisteproteiinissa tiettyä sokeria sitova lektiinin kaltainen domeeni. Toisella osapuolella taas on sokeriryhmä. On tietenkin edullista, että ainakin toisia tunnistesignaaleja voidaan tehdä suuri määrä erilaisia pienestä määrästä erilaisia monomeerejä ja käyttämättä suurta määrää monomeerejä. B. Sekundääri- ja tertiäärirakenteesta a) Karboksipeptidaasi on n. 00 aminohappotähteen proteiini, joka on suunnilleen pallomainen (säde 5 Å). Miten monta aminohappoa voisi enintään olla pisimmässä mahdollisessa α-heeliksissä eli α- kierteessä? Entä β-laskoksessa? α-heeliksissä toistojakso,6 aminohappoa per kierros ja kierroksen pituus on 5,4 Å (eli 540 pm). Näin ollen on noustu matka,5 Å/aminohappo. 50 Å:n eli halkaisijan matkalle mahtuu siis enintään a aminohappoa, a,5 Å < 50 Å, a < 500/5,. a=. Pitkin proteiinin halkaisijaa kulkevaan α- heeliksiin mahtuisi siis aminohappoa. (Proteiinin pinnalle vähemmän, sillä α-heeliksi ei ole kovin taipuisa.) β-laskoksessa harjanteiden (/\/\/\) välinen etäisyys on kaksi aminohappoa ja n. 7 Å, joten aminohappojen välinen etäisyys on n.,5 Å ja siis suoraan β-laskokseen mahtuisi enintään b aminohappoa, b,5 Å < 50 Å, b < 500/5 4,, joten b=4. β-laskos voisi toki kiertyä ja kaartua jonkin verran ja jos laskisi β-käännökset osaksi β-laskosta, niin silloin vaikka koko proteiini voisi muodostua β-laskoksesta ja β-käännöksistä. b) Pienille laskostuneille proteiineille liuottimen kanssa kosketuksissa oleva pinta (solvent accessible surface area, joka kuvaa sitä, miten suuri on se pinta-ala, jolle (yleensä) vesimolekyyli voisi tunkeutua) on likimain suoraan verrannollinen tekijään M / ja laskostumattomille proteiineille puolestaan likimain suoraan verrannollinen tekijään M. M on kummassakin proteiinin massa. Selitä, mistä ero johtuu ja mitä se kertoo pienten proteiinien laskostumisesta.

3 Aminohappojen lukumäärä on likimain verrannollinen massaan. Siis laskostumattoman proteiinin jokseenkin avonaiselle ja satunnaiselle aminohappoketjulle on pinta-ala likimain yhden aminohapon pinta-ala kertaa aminohappojen lukumäärä. Koska aminohappjen lukumäärä N M ja koska A ketju =A ah N, on A M. Siispä laskostumaton ketju on avonainen. Jollekin säännöllisen muotoiselle kappaleelle puolestaan V k, A k ja L k, missä V on tilavuus, A pinta-ala, L yksiulotteinen etäisyys (esim. pituus, halkaisija tms.) ja k on mittakaava. Aminohappojen yhteistilavuus on suoraan verrannollinen massaan. Jos aminohapot ovat tiiviisti pakkautuneet proteiiniksi, on aminohappojen yhteistilavuus V ah V prot. Toisaalta jos pakkautumisen väliin jäävien tilojen määrä on suoraan verrannollinen tilavuuteen, on edelleen V prot V ah. Tällöin V prot M. Tällaiselle kappaleelle A V / M /. Koska liuottimelle altis pinta-ala kasvaisi, jos raot olisivat suuria, niin voidaan siis päätellä, että pienet proteiinit pakkautuvat likimain samanmuotoisiksi (jolloin likimain pallomainen rakenne vaikuttaa loogiselta) ja tiiviisti. c) Ns. Ramachandran plot tai Sasisekhran Ramakrishnan Ramachandran plot kuvaa peptidirungon sidosten sallittuja kulmia ja kulmia, joilla tietyt sekundäärirakenteet ovat mahdollisia. Tällainen kuvaaja voidaan piirtää myös eri aminohappotähteille erikseen (esimerkiksi laskemalla tietokonemallien avulla sallitut kulmat, joilla steeriset vuorovaikutukset eri asennoissa eivät ole liian epäedullisia). Miten tällaisissa kuvaajissa sallittujen kulmaparien osuus kaikista mahdollisista eroaisi alaniinin, valiinin ja glysiinin muodostamille ketjuille, kun niitä tarkastellaan suhteessa toisiinsa? Kaikilla aminohapoilla lukuun ottamatta proliiinia (joka oikeastaan onkin iminohappo) on samanlainen runko, joten erot johtuvat sivuketjuista. Valiinin sivuketju on -CH(-CH ), alaniinin -CH ja glysiinin vain -H. Valiinin suurin sivuketju rajoittaa eniten sallittujen kulmaparien määrää, glysiinille taasen sallittujen kulmaparien määrä on suurin, koska sen sivuketju on mitättömän pieni eli pelkkä vety. Alaniini sijoittuu näiden väliin. Tehtävä : Sekvenssistä kolmiulotteiseksi proteiiniksi tryptofaanisyntaasi 0 0 p. A. 40 vuotta sitten C. Yanofsky ym. tutkivat 960-luvulla aminohappovaihdosten vaikutusta entsyymiaktiviteettiin. Koesarjassa tutkittiin mutaatioiden vaikutusta E. coli -bakteerin tryptofaanisyntaasi-entsyymiin (Science 46:59 (964)). Sittemmin mutaatioiden vaikutuksiin perustava lähestymistapa on tullut yhdeksi keskeisimmistä solu- ja molekyylibiologian menetelmistä. Aminohappo sekvenssin kohdassa A vaihtui mutanteissa toiseksi aminohapoksi mm. seuraavasti: entsyymi aminohappo kohdassa A aktiivisuus wild type Gly täysi mutantti Glu puuttuu mutantti Arg puuttuu mutantti Ser täysi mutantti 4 Ala täysi mutantti 5 Val osittainen (wild type = luonnossa (pääasiallisesti) esiintyvä muoto) Tutkimuksen edetessä todettiin että muntanttientsyymeissä esiintyy aminohappovaihdoksia kohdan A lisäksi myös toisessa kohdassa. entsyymi aminohappo A aminohappo B aktiivisuus wild type Gly Tyr täysi mutantti Glu Tyr puuttuu mutantti 6 Glu Cys osittainen mutantti 7 Gly Cys puuttuu

4 Aikakauden tekniikalla pystyttiin selvittämään aminohappojen A ja B sijaitsevan peptidiketjussa 6 aminohapon päässä toisistaan. Riittävällä varmuudella voitiin osoittaa että muita aminohappovaihdoksia ei ole tapahtunut. Entsyymin koko aminohappojärjestys saatiin kuitenkin selville vasta joitakin vuosia myöhemmin. Muodosta tulosten perusteella hypoteesi aminohappojen A ja B merkityksestä entsyymin toiminnassa. Selitä mutantin 6 aktiivisuus mallisi perusteella. Vinkki: hae oppikirjasta esiin aminohappojen rakenteet. Oheiseen taulukkoon piirretty aminohappojen sivuketjut H glysiini tyrosiini WILD TYPE täysi aktiivisuus C O glutamaatti tyrosiini MUTANTTI ei aktiivisuutta

5 NH C NH NH arginiini tyrosiini MUTANTTI ei aktiivisuutta seriini tyrosiini MUTANTTI täysi aktiivisuus CH alaniini tyrosiini MUTANTTI 4 täysi aktiivisuus

6 CH CH CH valiini tyrosiini MUTANTTI 5 osittainen aktiivisuus C O SH glutamaatti kysteiini MUTANTTI 6 osittainen aktiivisuus H glysiini SH kysteiini MUTANTTI 7 ei aktiivisuutta Oheisesta taulukosta helposti nähdään, ettei sivuketjujen polaarisuus, vetysitoutuminen tai varaus vaikuta,esim. glysiinin substituutio sekä alaniiniksi että seriiniksi säilyttää aktiivisuuden ja toisaalta glysiinin substituutio suuriksi aminohapoiksi kuten positiivisesti varatuksi arginiiniksi, negatiivisesti varatuksi glutamaatiksi tai neutraaliksi valiiniksi heikentää aktiivisuutta. Tämän vahvistaa se, että paikan B aminohapon muuttuminen tyrosiinista pienimmäksi kysteiiniksi palauttaa osin aktiivisuutta mutantissa 6. Jos molemmat aminohapot ovat pieniä (mutantti 7), niin aktiivisuus menetetään. Mutanttien perusteella looginen hypoteesi on, että aminohapot A ja B sijaitsevat entsyymin aktiivisessa kohdassa ja että niiden yhteensä viemä tila on tärkein aktiivisuuteen vaikuttava tekijä, ts. jos molemmat ovat suuria, substraatti ei mahdu sitoutumaan ja jos molemmat ovat pieniä, on sitoutumistasku liian väljä, jotta substraatti orientoituisi oikein.

7 B. Uudet tuulet Ylläolevat tulokset pystyttiin todellisuudessa selittämään vasta vuosikymmeniä myöhemmin kun entsyymin kolmiulotteinen rakenne ratkaistiin. Tutki esim. Rasmol-ohjelmalla tryptofaanisyntaasin kiderakennetta. Aminohapot A ja B ovat ovat kyseisissä rakenteissa tyr75 ja gly. Tiedostossa BKS.PDB on wild-type entsyymin kiderakenne. Entsyymi on myös kiteytetty substraattianalogi indolipropanolifosfaatin (IPL) kanssa (tiedosto QOP.PDB). Tässä rakenteessa IPL molekyyli on sitoututuneena tryptofaanisyntaasin alfaketjun aktiiviseen kohtaan. Miten kiderakenteet muuttavat 960-luvulla tekemääsi hypoteesia? Ladataan Rasmol-ohjelmaan kiderakenne Protein Data Bankista (www.rcsb.org/pdb/). Valitaan esim. =>display=>ribbons. Kirjoitetaan komentoriville "select IPL" (enter) "spacefill" (enter) "colour orange" (enter), jolloin saadaan aktiivisessa kohdassa oleva substraattianalogi osoittamaan aktiivisen kohdan paikkaa: Valitaan nyt Gly ja Tyr75, jotta näemme, miten ne sijaitsevat suhteessa aktiiviseen kohtaan. Kirjoitetaan komentoriville "select Gly" (enter) "spacefill" (enter) "colour blue" (enter) "select Tyr75" (enter) "spacefill" (enter) "colour red" (enter). Nyt näemme, miten aminohapot A ja B sijaitsevat suhteessa aktiiviseen kohtaan. Aminohappo A eli tässä tapauksessa glysiini näkyy kuvassa sinisenä ja aminohappo B eli tyrosiini 75 punaisena. Substraatin sitoutumispaikkaa osoittava substraattianalogi näkyy kuvassa oranssina. Kuvan perusteella voidaan päätellä, että alkuperäinen hypoteesi on mitä todennäköisimmin oikea, sillä molemmat aminohapot ovat aktiivisessa kohdassa ja vieläpä aivan vierekkäin samalla puolella substraatin sitoutumispaikkaa ja lähikontaktissa substraattiin.....

8 ... C. Ovatko kaikki bakteerit samaa maata? Kiderakenteet ovat Salmonella typhimurium -bakteerin entsyymistä. Escherichia colin entsyymiä ei ole onnistuttu kiteyttämään eikä näin ollen tarkkaa tietoa kolmiulotteisesta rakenteesta ole. Tee tietokantoja käyttämällä sekvenssihaku ja tutki kuinka homologisia näiden kahden bakteerin tryptofaanisyntaasit ovat. Kuinka hyvin tämä homologia kuvaa kolmiulotteisen rakenteen samankaltaisuutta? Menemällä sivulle ja valitsemalla Swiss-Prot/TrEMBL-haku voidaan hakea Salmonella typhimuriumin tryptofaanisyntaasin α-ketjun sekvenssi. Valitaan oikeasta yläkulmasta Blastp-ajo. Ohjelma hakee lähisukuisia sekvenssejä ja vertailee niitä. Saadaan 78 %:n identiteetti E. colin sekvenssin kanssa, joka löytyy listalta. Painamalla kyseisestö ikkunasta align-linkkiä päästään sivulle, joka antaa seuraavat tulokset: CLUSTAL FORMAT for T-COFFEE Version_.7, CPU=0. sec, SCORE=870, Nseq=, Len=68 sp P0099 TRPA_SALTY MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD sp P0098 TRPA_ECOLI MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD *****.*****::*:**************************:*********:******** sp P0099 TRPA_SALTY GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ sp P0098 TRPA_ECOLI GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK *******.*********************:******************:*** ***:**: sp P0099 TRPA_SALTY VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS sp P0098 TRPA_ECOLI VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA ***************************:*****************:*************: sp P0099 TRPA_SALTY GVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKI sp P0098 TRPA_ECOLI GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI ********.****:**: *****:***.*******:*:**.**: ***************

9 sp P0099 TRPA_SALTY IEKNLASPKQMLAELRSFVSAMKAASRA sp P0098 TRPA_ECOLI IEQHINEPEKMLAALKVFVQPMKAATRS **:::.*::*** *: **..****:*: Nähdään, että sekvenssit ovat enimmäkseen samat, joten on syytä olettaa, että kolmiulotteiset rakenteet todennäköisesti vastaavat melko hyvin toisiaan. Huomautettakoon, että lisäksi tiedetään, että E. colin ja S. typhimuriumin entsyymin eri alayksiköt muodostavat keskenään toimivia kokonaisuuksia. Näin ollen vaikuttaa luultavalta, että rakenteellinen vastaavuus on ainakin meidän tehtävämme kannalta tarpeeksi hyvä. Tehtävä : Periferaalinen membraaniproteiini sytokromi c (cytochrome c) 0 8 p. Sytokromi c:n sekvenssiä voidaan käyttää lajien sukulaisuussuhteiden määrittämiseen (esim. Lehningeristä löydät kuvan), koska se on evolutiivisesti hyvin vanha proteiineja ja monissa sen sekvenssin aminohapoissa esiintyy vain vähän muuntelua eli ne ovat konservoituneita (conserved). Yleensä tällaisten aminohappojen ajatellaan olevan erityisen tärkeitä proteiinin rakenteen ja funktion kannalta. Sekvenssivertailuohjelmilla (esim. ClustalW) voidaan nähdä, miten ne sijoittuvat sekvenssissä. Havainnollisempaa on kuitenkin nähdä, miten ne sijoittuvat proteiiniin. Tämä onnistuu ConSurfin avulla, joka tarvitsee tunnetun proteiinirakenteen ja sen jälkeen itse tekee PSI-BLAST haun, jossa se etsii tunnetuista sekvensseistä 50 samankaltaisinta ja jonka perusteella se sitten puolestaan värittää tunnetun rakenteen aminohappotähteet sen mukaan, miten konservoituneita ne ovat. Käytä ConSurfissa (http://consurf.tau.ac.il/index.html) tunnettua rakennetta, jonka PDB-koodi on HRC. (Huom! Varmista, että koneella on Chime asennettuna, sillä tuloksien tarkasteluun käytettävä Protein Explorer tarvitsee sen toimiakseen. Ellei ole, sen saa imuroitua ilmaiseksi osoitteesta joskin rekisteröitymistä edellytetään.) Tuloksia tarkastellessasi kokeile myös toista katsontatapaa (hiiren oikea näppäin, Select Protein; hiiren oikea näppäin, Display Ribbons). Tämä katsontatapa helpottaa merkittävästi b- ja c-kohtia. a) Tälle proteiinille löydät pikaisestikin oppikirjaa selaamalla ja toisaalta PubMed-haun (http://www.ncbi.nih.gov/entrez/query.fcgi) avulla kaksi toisistaan poikkeavaa biologista toimintoa. Mitkä ne ovat? Mikä prosteettinen ryhmä proteiinin keskellä on? Sytokromi c toimii toisaalta elektroninsiirtäjänä elektroninsiirtoketju(i)ssa ja toisaalta toimii apoptoosin eli ohjelmoidun solukuoleman signaaliketjussa ja aktivoi ohjelmoidun solukuoleman prosesseja vapautuessaan mitokondrioista. Prosteettinen ryhmä proteiinin keskellä on hemi, joka koostuu porfyriinistä ja siihen koordinoidusta rautaionista. b) Miten konservoituneet ja muuttuvat aminohapot sijoittuvat proteiinin rakenteeseen? Liitä esim. kuva ja lyhyt sanallinen selostus tai pelkästään jälkimmäinen, jos kuvan liittämisessä ongelmia.

10

11 Katsomalla kuvia havaitaan, että suuri osa konservoituneista aminohapoista keskittyy prosteettisen ryhmän ympärillä ja toisaalta kyljelle, joka on lähellä prosteettista ryhmää. Vaikuttaa siis ilmeiseltä, että ne osallistuvat toiminnan kannalta keskeisiin prosesseihin, joihin vaaditaan prosteettista ryhmää ja toisaalta sen vuorovaikutusta ympäristön kanssa. c) Rakenteessa näkyy hajanaisesti konservoituneita aminohappoja muuallakin. Valitse hiiren oikealla näppäimellä Select Residue GLY. Valitse jälleen hiiren oikealla näppäimellä esim. Display Ball and stick ja kokeile myös Display Spacefill van der Waals radii. Millaisissa rakenteen kohdissa glysiinit näyttäisivät pääosin esiintyvän? Mikä voisi olla syynä siihen, että juuri glysiinit esiintyvät tällaisissa paikoissa? Oheisessa kuvassa glysiinit valittu ja asetettu ohjelma näyttämään ne spacifill-asetuksilla, jotta ne erottuvat muusta proteiinista. Havaitaan, että suuri osa glysiineistä sijaitsee äkillisissä käännöksissä. Syynä esiintymiseen tällaisissa paikoissa voisi olla se, että glysiinin sivuketju on pieni ja se pystyy esiintymään monissa eri kulmissa ilman sivuketjun aiheuttamia steerisiä esteitä (katso tehtävää ).

12 Tehtävä 4: Integraalinen membraaniproteiini akvaporiini (aquaporin, aquaporin-chip) 0 0 p. Tänä vuonna toinen kemian alan Nobel-palkinnon saajista eli Peter Agre sai palkintonsa akvaporiinien löytämisestä. Ainakin Ruotsin Kuninkaallinen Tiedeakatemia siis ilmeisesti piti moista oivana tekona, joten tutustukaamme siihen, mistä oikein on kysymys. A) Akvaporiinien toiminnasta a) Selitä lyhyesti, mitä akvaporiinit tekevät (nimestäkin sen jo arvaa). Akvaporiinit ovat kanavia, jotka päästävät selektiivisesti (lähinnä) vettä lävitseen. b) Selitä lyhyesti, mikä määrää (netto)kulkusuunnan akvaporiinimolekyylin läpi. Akvaporiini on kanava eikä pumppu, joten kulkusuunnan määrää veden aktiivisuus kalvon eri puolilla (/ osmoottinen paine / vapaan veden pitoisuus). c) Selitä lyhyesti, miten akvaporiinit liittyvät munuaisten toimintaan ja miksi siis niillä saattaisi olla merkitystä esim. lääketieteen kannalta. Jos päädyt tekemään hakuja verkossa, voit käyttää hakuja tehdessäsi esim. joitakin hakusanoista hakusanoja ADH, aquaporin, vasopressin, renal, fluid retention. Akvaporiinit osallistuvat munuaissoluissa vesivirtojen säätelyyn. Laimeaa primäärivirtsaa syntyy vuorokaudessa lähes 00 litraa. Suurin osa sen vedestä imeytyy takaisin elimistöön. Muutenkin munuaisen toiminnan kannalta keskeistä on konsentraatiogradienttien synnyttäminen, mikä puolestaan edellyttää munuaisen eri osien erilaista vedenläpäisevyyttä, mikä on mahdollista akvaporiinien ansiosta. Tärkeä on rooli akvaporiinilla on myös kokoojaputkissa, joissa akvaporiini- siirtyy antidiureettisen hormonin vaikutuksesta solun sisällä olevista kalvorakkuloista solukalvoon, jolloin vedenläpäisevyys kasvaa ja enemmän vettä imeytyy takaisin. Akvaporiini on siis keskeinen elimistön nestetasapainon säätelyssä. Nestetasapainoon vaikuttaminen on puolestaan keskeistä esim. sydämen vajaatoiminnassa ja toisinaan myös verenpaineen hoidossa (ns. nesteenpoistolääkkeet lienevät monille tuttuja).

13 B) Akvaporiinin sekvenssistä a) Hae Swiss-Protin (http://us.expasy.org/sprot/) avulla naudan (Bos taurus) aquaporin-chipsekvenssi. Syötä hakutuloksesi BLASTiin (klikkaa hakutulossivun alalaidasta "BLAST submission on ExPASy/SIB"). Millaisia proteiineja löydät hakutuloksiesi joukosta? Ohjelmalle antamaasi sekvenssiä muistuttavia proteiineja löytynee sekä samasta eliöstä että muista eliöistä. Mitä tämä kertoo proteiinien kehittymisestä menneiden aikojen kuluessa? Klikkaa hakutulosten kuvamuotoisen esitystavan ylälaidassa olevaa Pfam-valikkoa, josta saat lisätietoja proteiiniperheestä. Entä miten proteiinien evoluutio ja sukupuu muuttuisi mielenkiintoisemmaksi ja monimutkaisemmaksi, jos kyseessä olisi proteiini, jolla on monta domeenia? (Vastataksesi tähän selvitä itsellesi, mikä on domeenin määritelmä ja mitkä ovat sille tyypillisiä piirteitä suhteessa geenien eksoneihin ja toimintoihin.) Läheisimmät sukulaiset ovat akvaporiinin samaa isomuotoa eri lajeilta ja kaukaisempina sukulaisina löytyy akvaporiinin eri isomuotoja samalta ja muilta lajeilta. Toisaalta tämä tietysti kertoo sen, että funktiot ovat erilaistuneet ennen lajien erkaantumista. Lisäksi nähdään myös se, että proteiinit paitsi muuttuvat mutaatioiden tuloksena, niiden geeni voi myös kahdentua ja alkaa erilaistua eri proteiiniksi/isomuodoksi (jolla on myös erilaistuneet toiminnot). Monet eri domeenit muuttaisivat tilannetta siten, että domeeneilla olisi oma kehityshistoriansa. Yhden domeenin sukulaisia saattaisia esiintyä monissa eri proteiineissa, joiden muut domeenit eivät olisi samalla tavalla sukua keskenään. b) Ota muistiin naudan sekvenssin nimi. Elät toistaiseksi menneisyydessä ja haluat selvitellä sekvenssin perusteella joitakin alkeellisia tietoja proteiinien rakenteesta eli transmembraaniheeliksien määrää. Tässä apuna toimiin Stephen Whiten laboratorion Membrane Protein Explorer (http://blanco.biomol.uci.edu/mpex/). Kokeile ohjelmalla hieman eri hydropaattisuusasteikkoja (avautuvan Java-ikkunan oikealla puolella. Montako transmembraaniheeliksiä ohjelma ennustaa akvaporiinilla olevan? Selitä muutamin sanoin myös se periaate, johon tuollainen ennustus yleensä perustuu. Nähdään ohjelman ennustavan kuusi transmembraaniheeliksiä oletusasetuksilla. Tällaiset ennusteet perustuvat siihen, että ohjelmat etsivät erilaisiin hydrofobisuusasteikkoihin perustuen

14 aminohapposekvenssistä jaksoja, joissa olisi tarpeeksi pitkä jakso (9 0) aminohappoja transmembraaniheeliksiä varten. C) Akvaporiinin rakenteesta Onneksi naudan akvaporiinin rakenne on saatu jo selvitettyä. Sen PDB-koodi on J4N. Imuroi tiedosto Protein Data Bank -palvelusta (http://www.rcsb.org/pdb/). Tarkastele rakennetta esimerkiksi Rasmolin tai Chimen avulla (jälkimmäisessä tapauksessa avaa tiedosto selainohjelmaan, joka osaa Chime plugin -ohjelman avulla avata pdb-tiedoston). a) Väritä proteiinin hydrofiiliset/polaariset ja toisaalta hydrofobiset aminohapot eri väreillä. Onko tuloksessa mitään järkeä? Minkä mielenkiintoisen seikan huomaat membraanin uppoutuneiden heeliksien lukumäärän ja rakenteen suhteen (vertaa Bb-kohdassa saamiisi ennusteisiin)? Havaitaan, että polaariset aminohapot ovat enimmäkseen proteiinin muodostaman kanavan sisäpinnalla ja kalvon läp kulkevan osan ulkopuolella, kun taas kalvon läpäisevän osan lipideitä kohti suuntautuvat aminohapot ovat enimmäkseen hydrofobisia. Tuloksessa on mitä ilmeisimmin järkeä, sillä polaariset aminohapot ovat niitä, jotka ovat kontaktissa veden kanssa ja hydrofobiset niitä, jotka ovat kontaktissa lipidien rasvahappoketjujen kanssa. Nähdään, että varsinaisia transmembraaniheeliksejä on seitsemän. Lisäksi nähdään, että rakenteessa esiintyy yksi kahdesta lyhyestä heeliksistä muodostuva transmembraanijakso, jota transmembraaniennustusohjelman ei oikein voisikaan olettaa löytävän, koska se etsii yhtenäisiä jaksoja, jotka ovat tarpeeksi pitkiä.

15 b) Tee sille samanlainen temppu kuin tehtävässä eli väritetä se ConSurf-ohjelman avulla aminohappojen konservoituneisuuden mukaan. Millaisen tuloksen sait ja miksi se oikeastaan oli odotettu, siis miksei mikä hyvänsä polaarinen aminohappo kelpaa konservoituneen alueen tilalle? Nähdään, että konservoituneet aminohapot ovat keskittyneet kanavan sisään. Tämä oli odotettavissa, koska kanavan täytyy toimia siten, että se päästää pelkästään vettä lävitseen, muttei muita polaarisia yhdisteitä kuten H O + :aa. Näin ollen mikä tahansa polaarinen aminohappo ei kelpaa kanavan sisälle, vaan niiden täytyy olla juuri sellaisia, että ne takaavat tuon selektion. Siksi aminohappovaihdokset kanavan sisällä johtaisivat todennäköisemmin toimimattomaan proteiiniin ja mutaation karsiutumiseen luonnonvalinnassa. Näin ollen juuri kanavan sisäosa on konservoitunut.

Vastaa lyhyesti selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan

Vastaa lyhyesti selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan 1 1) Tunnista molekyylit (1 piste) ja täytä seuraava taulukko (2 pistettä) a) b) c) d) a) Syklinen AMP (camp) (0.25) b) Beta-karoteeni (0.25 p) c) Sakkaroosi (0.25 p) d) -D-Glukopyranoosi (0.25 p) 2 Taulukko.

Lisätiedot

Peptidi ---- F ----- K ----- V ----- R ----- H ----- A ---- A. Siirtäjä-RNA:n (trna:n) (3 ) AAG UUC CAC GCA GUG CGU (5 ) antikodonit

Peptidi ---- F ----- K ----- V ----- R ----- H ----- A ---- A. Siirtäjä-RNA:n (trna:n) (3 ) AAG UUC CAC GCA GUG CGU (5 ) antikodonit Helsingin yliopisto/tampereen yliopisto Henkilötunnus - Biokemian/bioteknologian valintakoe Sukunimi 24.5.2006 Etunimet Tehtävä 3 Pisteet / 20 Osa 1: Haluat selvittää -- F -- K -- V -- R -- H -- A peptidiä

Lisätiedot

Proteiinin rakenteen selvittämisestä ja visualisoinnista

Proteiinin rakenteen selvittämisestä ja visualisoinnista TKK Solubiosysteemien perusteet syksy 2002 Harkkatyö M.Tarvainen Proteiinin rakenteen selvittämisestä ja visualisoinnista 1. Yleistä proteiineista 2. Röntgensädekristallografia 3. Ydinmagneettinen resonanssimenetelmä

Lisätiedot

DNA, RNA ja proteiinirakenteen ennustaminen

DNA, RNA ja proteiinirakenteen ennustaminen S-114.500 Solubiosysteemien perusteet Harjoitustyö Syksy 2003 DNA, RNA ja proteiinirakenteen ennustaminen Ilpo Tertsonen, 58152p Jaakko Niemi, 55114s Sisällysluettelo 1. Alkusanat... 3 2. Johdanto... 4

Lisätiedot

PROTEIINIEN MUOKKAUS JA KULJETUS

PROTEIINIEN MUOKKAUS JA KULJETUS PROTEIINIEN MUOKKAUS JA KULJETUS 1.1 Endoplasmakalvosto Endoplasmakalvosto on organelli joka sijaitsee tumakalvossa kiinni. Se on topologisesti siis yhtä tumakotelon kanssa. Se koostuu kahdesta osasta:

Lisätiedot

Molekyyli- ja solubiologia ELEC-2210 Proteiinit

Molekyyli- ja solubiologia ELEC-2210 Proteiinit Molekyyli- ja solubiologia ELEC-2210 Proteiinit Vuento & Heino: Biokemian ja solubiologian perusteet, ss. 51-66 Alberts et al. Essential Cell Biology, 4. p, luku 4 Dos. Tuomas Haltia, HY, Biotieteiden

Lisätiedot

Evoluutiopuu. Aluksi. Avainsanat: biomatematiikka, päättely, kombinatoriikka, verkot. Luokkataso: 6.-9. luokka, lukio

Evoluutiopuu. Aluksi. Avainsanat: biomatematiikka, päättely, kombinatoriikka, verkot. Luokkataso: 6.-9. luokka, lukio Evoluutiopuu Avainsanat: biomatematiikka, päättely, kombinatoriikka, verkot Luokkataso: 6.-9. luokka, lukio Välineet: loogiset palat, paperia, kyniä Kuvaus: Tehtävässä tutkitaan bakteerien evoluutiota.

Lisätiedot

ISIS Draw (Windows versio 2.5)

ISIS Draw (Windows versio 2.5) 1 ISIS Draw (Windows versio 2.5) ISIS Draw on helppokäyttöinen kemian piirto-ohjelma, jolla voidaan muun muassa piirtää kemiallisia rakenteita, reaktioyhtälöitä ja yksinkertaisia proteiinirakenteita. Lisäksi

Lisätiedot

Sukunimi 26. 05. 2005 Etunimet Tehtävä 3 Pisteet / 20

Sukunimi 26. 05. 2005 Etunimet Tehtävä 3 Pisteet / 20 Helsingin yliopisto/tampereen yliopisto Henkilötunnus - Biokemian/bioteknologian valintakoe Sukunimi 26. 05. 2005 Etunimet Tehtävä 3 Pisteet / 20 3: Osa 1 Tumallisten solujen genomin toiminnassa sekä geenien

Lisätiedot

ENTSYYMIKATA- LYYSIN PERUSTEET (dos. Tuomas Haltia)

ENTSYYMIKATA- LYYSIN PERUSTEET (dos. Tuomas Haltia) ENTSYYMIKATA- LYYSIN PERUSTEET (dos. Tuomas Haltia) Elämän edellytykset: Solun täytyy pystyä (a) replikoitumaan (B) katalysoimaan tarvitsemiaan reaktioita tehokkaasti ja selektiivisesti eli sillä on oltava

Lisätiedot

Moodle-oppimisympäristö

Moodle-oppimisympäristö k5kcaptivate Moodle-oppimisympäristö Opiskelijan opas Sisältö 1. Mikä on Moodle? 2. Mistä löydän Moodlen? 3. Kuinka muokkaan käyttäjätietojani? 4. Kuinka ilmoittaudun kurssille? 5. Kuinka käytän Moodlen

Lisätiedot

Tikon Web-sovellukset

Tikon Web-sovellukset Marraskuu 2014 1 (9) Tikon Web-sovellukset Marraskuu 2014 2 (9) 1 Johdanto... 3 2 Windows... 3 2.1 Microsoft Silverlight... 3 3 Tablet-laitteet... 4 4 Selaimet... 5 4.1 Yleiset asetukset (kaikki selaimet)...

Lisätiedot

Tilastolliset toiminnot

Tilastolliset toiminnot -59- Tilastolliset toiminnot 6.1 Aineiston esittäminen graafisesti Tilastollisen aineiston tallentamisvälineiksi TI-84 Plus tarjoaa erityiset listamuuttujat L1,, L6, jotka löytyvät 2nd -toimintoina vastaavilta

Lisätiedot

Selaimen asetukset. Toukokuu 2014 1 (7) Selaimen asetukset. 1994-2014 Tikon Oy. All rights reserved.

Selaimen asetukset. Toukokuu 2014 1 (7) Selaimen asetukset. 1994-2014 Tikon Oy. All rights reserved. Toukokuu 2014 1 (7) Selaimen asetukset Toukokuu 2014 2 (7) 1 Johdanto... 3 2 Windows... 3 3 Selaimet... 3 3.1 Yleiset asetukset (kaikki selaimet)... 3 3.1.1 Zoom-asetus... 3 3.1.2 Pop-up Blocker... 3 3.2

Lisätiedot

NXT Infrapuna-sensori

NXT Infrapuna-sensori NXT Infrapuna-sensori Joissakin tilanteissa on hyödyllistä, jos robotti tunnistaa ympäristöstä tulevaa infrapunavaloa. Tämä tieto on välttämätön esim. RCJ:n robottijalkapallossa. Tässä esitellään vain

Lisätiedot

DNA:n informaation kulku, koostumus

DNA:n informaation kulku, koostumus DNA:n informaation kulku, koostumus KOOSTUMUS Elävien bio-organismien koostumus. Vety, hiili, happi ja typpi muodostavat yli 99% orgaanisten molekyylien rakenneosista. Biomolekyylit voidaan pääosin jakaa

Lisätiedot

Kovalenttinen sidos ja molekyyliyhdisteiden ominaisuuksia

Kovalenttinen sidos ja molekyyliyhdisteiden ominaisuuksia Kovalenttinen sidos ja molekyyliyhdisteiden ominaisuuksia 16. helmikuuta 2014/S.. Mikä on kovalenttinen sidos? Kun atomit jakavat ulkoelektronejaan, syntyy kovalenttinen sidos. Kovalenttinen sidos on siis

Lisätiedot

Laskuharjoitus 9, tehtävä 6

Laskuharjoitus 9, tehtävä 6 Aalto-yliopiston perustieteiden korkeakoulu Jouni Pousi Systeemianalyysin laboratorio Mat-2.4129 Systeemien identifiointi Laskuharjoitus 9, tehtävä 6 Tämä ohje sisältää vaihtoehtoisen tavan laskuharjoituksen

Lisätiedot

Tikon Web-sovellukset

Tikon Web-sovellukset Toukokuu 2015 1 (11) Tikon Web-sovellukset Toukokuu 2015 2 (11) 1 Johdanto... 3 2 Silverlight sovellukset... 3 2.1 Windows... 3 2.1.1 Microsoft Silverlight... 3 2.1.2 Tablet-laitteet... 4 2.1.3 Selaimet...

Lisätiedot

PRELIMINÄÄRIKOE PITKÄ MATEMATIIKKA 9.2.2011

PRELIMINÄÄRIKOE PITKÄ MATEMATIIKKA 9.2.2011 PRELIMINÄÄRIKOE PITKÄ MATEMATIIKKA 9..0 Kokeessa saa vastata enintään kymmeneen tehtävään.. Sievennä a) 9 x x 6x + 9, b) 5 9 009 a a, c) log 7 + lne 7. Muovailuvahasta tehty säännöllinen tetraedri muovataan

Lisätiedot

Ongelma(t): Miten merkkijonoja voidaan hakea tehokkaasti? Millaisia hakuongelmia liittyy bioinformatiikkaan?

Ongelma(t): Miten merkkijonoja voidaan hakea tehokkaasti? Millaisia hakuongelmia liittyy bioinformatiikkaan? Ongelma(t): Miten merkkijonoja voidaan hakea tehokkaasti? Millaisia hakuongelmia liittyy bioinformatiikkaan? 2012-2013 Lasse Lensu 2 Ihmisen, eläinten ja kasvien hyvinvoinnin kannalta nykyaikaiset mittaus-,

Lisätiedot

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan 1. a) Mitä tarkoitetaan biopolymeerilla? Mihin kolmeen ryhmään biopolymeerit voidaan jakaa? (1,5 p) Biopolymeerit ovat luonnossa esiintyviä / elävien solujen muodostamia polymeerejä / makromolekyylejä.

Lisätiedot

Öljysäiliö maan alla

Öljysäiliö maan alla Kaigasniemen koulu Öljysäiliö maan alla Yläkoulun ketaava ja syventävä matematiikan tehtävä Vesa Maanselkä 009 Ostat talon jossa on öljylämmitys. Takapihalle on kaivettu maahan sylintein muotoinen öljysäiliö

Lisätiedot

MATEMATIIKKA 5 VIIKKOTUNTIA. PÄIVÄMÄÄRÄ: 8. kesäkuuta 2009

MATEMATIIKKA 5 VIIKKOTUNTIA. PÄIVÄMÄÄRÄ: 8. kesäkuuta 2009 EB-TUTKINTO 2009 MATEMATIIKKA 5 VIIKKOTUNTIA PÄIVÄMÄÄRÄ: 8. kesäkuuta 2009 KOKEEN KESTO: 4 tuntia (240 minuuttia) SALLITUT APUVÄLINEET: Eurooppa-koulun antama taulukkovihkonen Funktiolaskin, joka ei saa

Lisätiedot

MATEMATIIKKA 5 VIIKKOTUNTIA

MATEMATIIKKA 5 VIIKKOTUNTIA EB-TUTKINTO 2008 MATEMATIIKKA 5 VIIKKOTUNTIA PÄIVÄMÄÄRÄ: 5. kesäkuuta 2008 (aamupäivä) KOKEEN KESTO: 4 tuntia (240 minuuttia) SALLITUT APUVÄLINEET: Europpa-koulun antama taulukkovihkonen Funktiolaskin,

Lisätiedot

ASIO-OHJE HENKILÖSTÖLLE. www.laurea.fi

ASIO-OHJE HENKILÖSTÖLLE. www.laurea.fi ASIO-OHJE HENKILÖSTÖLLE www.laurea.fi ASIOssa henkilöstö voi: Varata tiloja mistä tahansa Laurean kampukselta Tarkastella omaa opetusaikataulua ja opetukselle varattuja tiloja kalenterinäkymässä Saada

Lisätiedot

3 Suorat ja tasot. 3.1 Suora. Tässä luvussa käsitellään avaruuksien R 2 ja R 3 suoria ja tasoja vektoreiden näkökulmasta.

3 Suorat ja tasot. 3.1 Suora. Tässä luvussa käsitellään avaruuksien R 2 ja R 3 suoria ja tasoja vektoreiden näkökulmasta. 3 Suorat ja tasot Tässä luvussa käsitellään avaruuksien R 2 ja R 3 suoria ja tasoja vektoreiden näkökulmasta. 3.1 Suora Havaitsimme skalaarikertolaskun tulkinnan yhteydessä, että jos on mikä tahansa nollasta

Lisätiedot

GeoGebra-harjoituksia malu-opettajille

GeoGebra-harjoituksia malu-opettajille GeoGebra-harjoituksia malu-opettajille 1. Ohjelman kielen vaihtaminen Mikäli ohjelma ei syystä tai toisesta avaudu toivomallasi kielellä, voit vaihtaa ohjelman käyttöliittymän kielen seuraavasti: 2. Fonttikoon

Lisätiedot

KÄYTTÖOHJE. Servia. S solutions

KÄYTTÖOHJE. Servia. S solutions KÄYTTÖOHJE Servia S solutions Versio 1.0 Servia S solutions Servia Finland Oy PL 1188 (Microkatu 1) 70211 KUOPIO puh. (017) 441 2780 info@servia.fi www.servia.fi 2001 2004 Servia Finland Oy. Kaikki oikeudet

Lisätiedot

zotero www.zotero.org

zotero www.zotero.org zotero www.zotero.org Viitteidenhallintajärjestelmä Zotero toimii Firefox-selaimessa. Muita ilmaisia viitteidenhallintajärjestelmiä ovat esimerkiksi EndNote ja Mendeley. Näissä ohjeissa on kuvataan Zoteron

Lisätiedot

Kenguru 2015 Student (lukiosarja)

Kenguru 2015 Student (lukiosarja) sivu 1 / 9 NIMI RYHMÄ Pisteet: Kenguruloikan pituus: Irrota tämä vastauslomake tehtävämonisteesta. Merkitse tehtävän numeron alle valitsemasi vastausvaihtoehto. Väärästä vastauksesta saat miinuspisteitä

Lisätiedot

Peptidisynteesi. SPPS:n Periaate

Peptidisynteesi. SPPS:n Periaate Tapio Nevalainen Lääkeainesynteesit II 2011 eptidisynteesi i eptidisynteesi Suoritetaan yleensä kiinteän faasin pinnalla; solid phase peptide synthesis (SS) Suuret peptidiainemäärät valmistetaan liuosfaasissa.

Lisätiedot

Garmin Astro ohjelmistopäivitys

Garmin Astro ohjelmistopäivitys Garmin Astro ohjelmistopäivitys Laitteen ohjelmisto päivitys kannattaa suorittaa silloin tällöin. Ohjelmistopäivityksellä voit saada laitteeseesi uusia ominaisuuksia ja parannuksia vanhoihin ominaisuuksiin.

Lisätiedot

Metropolia ammattikorkeakoulu 05.02.2015 TI00AA43-3004: Ohjelmointi Kotitehtävät 3

Metropolia ammattikorkeakoulu 05.02.2015 TI00AA43-3004: Ohjelmointi Kotitehtävät 3 : http://users.metropolia.fi/~pasitr/2014-2015/ti00aa43-3004/kt/03/ratkaisut/ Tehtävä 1. (1 piste) Tee ohjelma K03T01.cpp, jossa ohjelmalle syötetään kokonaisluku. Jos kokonaisluku on positiivinen, niin

Lisätiedot

HiTechnic -kompassisensorin käyttäminen NXT-G -ympäristössä

HiTechnic -kompassisensorin käyttäminen NXT-G -ympäristössä NXT -kompassisensori NXT -roboteihin on saatavilla kahdenlaisia kompasseja: Wiltronics kompassit (tilaukset: http://www.wiltronics.com.au/) ja HiTechnic kompassit (NMC1034 Compass) (tilaukset: http://www.hitechnic.com/products).

Lisätiedot

SUDOKU - ratkaisuohjeet. Jarno Tuimala 18.9.2005

SUDOKU - ratkaisuohjeet. Jarno Tuimala 18.9.2005 SUDOKU - ratkaisuohjeet Jarno Tuimala 18.9.2005 Japanilainen sudoku Seuraavassa on esitetty ohjeet japanilaistyyppisten sudoku-ristikoiden ratkontaan. Japanilaisia ristikoita luonnehtivat seuraavat piirteet:

Lisätiedot

Juha Haataja 4.10.2011

Juha Haataja 4.10.2011 METROPOLIA Taulukkolaskenta Perusteita Juha Haataja 4.10.2011 Lisätty SUMMA.JOS funktion käyttö (lopussa). Tavoite ja sisältö Tavoite Taulukkolaskennan peruskäytön hallinta Sisältö Työtila Omat kaavat,

Lisätiedot

TI-30X II funktiolaskimen pikaohje

TI-30X II funktiolaskimen pikaohje 0 TI-30X II funktiolaskimen pikaohje Sisältö Näppäimet... 1 Resetointi... 1 Aiempien laskutoimitusten muokkaaminen... 2 Edellisen laskutoimituksen tuloksen hyödyntäminen (ANS) ja etumerkki... 3 DEL ja

Lisätiedot

Excel syventävät harjoitukset 31.8.2015

Excel syventävät harjoitukset 31.8.2015 Yleistä Excel on taulukkolaskentaohjelma. Tämä tarkoittaa sitä että sillä voi laskea laajoja, paljon laskentatehoa vaativia asioita, esimerkiksi fysiikan laboratoriotöiden koetuloksia. Excel-ohjelmalla

Lisätiedot

S-114.2720 Havaitseminen ja toiminta

S-114.2720 Havaitseminen ja toiminta S-114.2720 Havaitseminen ja toiminta Heikki Hyyti 60451P Harjoitustyö 2 visuaalinen prosessointi Treismanin FIT Kuva 1. Kuvassa on Treismanin kokeen ensimmäinen osio, jossa piti etsiä vihreätä T kirjainta.

Lisätiedot

Nutri-Flow ravintotulkki ALOITUSOPAS

Nutri-Flow ravintotulkki ALOITUSOPAS Nutri-Flow ravintotulkki ALOITUSOPAS Ohjelmaan kirjautuminen Siirry osoitteeseen www.nutri-flow.fi Klikkaa sivun ylälaidassa näkyvää Nutri-Flow palvelu painiketta. Avautuvalla sivulla on tiedotteita ja

Lisätiedot

3. Kuvio taitetaan kuutioksi. Mikä on suurin samaa kärkeä ympäröivillä kolmella sivutahkolla olevien lukujen tulo?

3. Kuvio taitetaan kuutioksi. Mikä on suurin samaa kärkeä ympäröivillä kolmella sivutahkolla olevien lukujen tulo? Peruskoulun matematiikkakilpailu Loppukilpailu perjantaina 4.2.2011 OSA 1 Ratkaisuaika 30 min Pistemäärä 20 Tässä osassa ei käytetä laskinta. Esitä myös lasku, kuvio, päätelmä tai muu lyhyt perustelu.

Lisätiedot

TÄS ON PROTSKUU! Missä yhteyksissä olet törmännyt sanaan proteiini tai valkuaisaine?

TÄS ON PROTSKUU! Missä yhteyksissä olet törmännyt sanaan proteiini tai valkuaisaine? TÄS ON PROTSKUU! KOHDERYHMÄ: Työ soveltuu parhaiten yläkouluun kurssille elollinen luonto ja yhteiskunta, sekä lukioon kurssille KE1. KESTO: Työ koostuu kahdesta osasta: n. 30 min/osa. MOTIVAATIO: Mitä

Lisätiedot

3 Raja-arvo ja jatkuvuus

3 Raja-arvo ja jatkuvuus 3 Raja-arvo ja jatkuvuus 3. Raja-arvon käsite Raja-arvo kuvaa funktion kättätmistä jonkin lähtöarvon läheisdessä. Raja-arvoa tarvitaan toisinaan siksi, että funktion arvoa ei voida laskea kseisellä lähtöarvolla

Lisätiedot

5.3 Ensimmäisen asteen polynomifunktio

5.3 Ensimmäisen asteen polynomifunktio Yllä olevat polynomit P ( x) = 2 x + 1 ja Q ( x) = 2x 1 ovat esimerkkejä 1. asteen polynomifunktioista: muuttujan korkein potenssi on yksi. Yleisessä 1. asteen polynomifunktioissa on lisäksi vakiotermi;

Lisätiedot

,QWHUQHWVHODLPHQNl\WWlPLQHQ±,QWHUQHW([SORUHU

,QWHUQHWVHODLPHQNl\WWlPLQHQ±,QWHUQHW([SORUHU ,QWHUQHWVHODLPHQNl\WWlPLQHQ±,QWHUQHW([SORUHU Tässä pääsette tutustumaan Internet Explorerin (IE) käyttöön. Muitakin selainversioita löytyy, kuten esimerkiksi Netscape, Opera ja Mozilla. Näiden muiden selainten

Lisätiedot

Posterin teko MS Publisherilla

Posterin teko MS Publisherilla Posterin teko MS Publisherilla Ensimmäisenä avaa MS Publisher 2010. Löydät sen Windows valikosta - All programs - Microsoft Office. Publisheriin avautuu allaolevan kuvan mukainen näkymä. Mikäli et näe

Lisätiedot

Kenguru 2011 Benjamin (6. ja 7. luokka)

Kenguru 2011 Benjamin (6. ja 7. luokka) sivu 1 / 6 NIMI LUOKKA/RYHMÄ Pisteet: Kenguruloikan pituus: Irrota tämä vastauslomake tehtävämonisteesta. Merkitse tehtävän numeron alle valitsemasi vastausvaihtoehto. Jätä ruutu tyhjäksi, jos et halua

Lisätiedot

Jatkuvat satunnaismuuttujat

Jatkuvat satunnaismuuttujat Jatkuvat satunnaismuuttujat Satunnaismuuttuja on jatkuva jos se voi ainakin periaatteessa saada kaikkia mahdollisia reaalilukuarvoja ainakin tietyltä väliltä. Täytyy ymmärtää, että tällä ei ole mitään

Lisätiedot

Kiinalaiset kuvakirjaimet ( Kanjit)

Kiinalaiset kuvakirjaimet ( Kanjit) Kiinalaiset kuvakirjaimet ( Kanjit) Japanilaiset omaksuivat kiinalaiset kuvakirjaimet, eli Kanjit, 500-700 luvulla j.kr. mutta tieteiden, taiteiden, ja Buddhismin mukana niitä on omaksuttu lisää mantereelta

Lisätiedot

Proteiinien opiskelua molekyyligastronomian kontekstissa kohti korkeamman tason ajattelutaitoja ja mahdollisimman kuohkeita marenkeja

Proteiinien opiskelua molekyyligastronomian kontekstissa kohti korkeamman tason ajattelutaitoja ja mahdollisimman kuohkeita marenkeja LUMAT 1(2), 2013 Proteiinien opiskelua molekyyligastronomian kontekstissa kohti korkeamman tason ajattelutaitoja ja mahdollisimman kuohkeita marenkeja Anna-Sofia Vilhunen Kemian opettajankoulutusyksikkö,

Lisätiedot

ASCII-taidetta. Intro: Python

ASCII-taidetta. Intro: Python Python 1 ASCII-taidetta All Code Clubs must be registered. Registered clubs appear on the map at codeclubworld.org - if your club is not on the map then visit jumpto.cc/18cplpy to find out what to do.

Lisätiedot

Biomolekyylit ja aineenvaihdunta I

Biomolekyylit ja aineenvaihdunta I Biomolekyylit ja aineenvaihdunta I Luentorunko Jarmo Niemi 2003-2007 1 Biomolekyylit ja aineenvaihdunta I Luennot 6 op. (3 ov) 2003-2007 Jarmo Niemi (jarmo.niemi@utu.fi) Biokemian ja elintarvikekemian

Lisätiedot

Kun olet valmis tekemään tilauksen, rekisteröidy sovellukseen seuraavasti:

Kun olet valmis tekemään tilauksen, rekisteröidy sovellukseen seuraavasti: HENKILÖKORTTIEN SUUNNITTELUSOVELLUS SOVELLUKSEN KÄYTTÖOHJE Voit kokeilla korttien suunnittelemista valmiiden korttipohjien avulla ilman rekisteröitymistä. Rekisteröityminen vaaditaan vasta, kun olet valmis

Lisätiedot

Mobiilit luontorastit

Mobiilit luontorastit Mobiilit luontorastit Kesto: Riippuu reitin pituudesta Kenelle: yläkoulu Missä: ulkona Milloin: kevät ja syksy Tarvikkeet: älypuhelin / tablettitietokone (muistiinpanovälineet) Eräpassin osio: Luonnossa

Lisätiedot

Epooqin perusominaisuudet

Epooqin perusominaisuudet Epooqin perusominaisuudet Huom! Epooqia käytettäessä on suositeltavaa käyttää Firefox -selainta. Chrome toimii myös, mutta eräissä asioissa, kuten äänittämisessä, voi esiintyä ongelmia. Internet Exploreria

Lisätiedot

Tasogeometria. Tasogeometrian käsitteitä ja osia. olevia pisteitä. Piste P on suoran ulkopuolella.

Tasogeometria. Tasogeometrian käsitteitä ja osia. olevia pisteitä. Piste P on suoran ulkopuolella. Tasogeometria Tasogeometrian käsitteitä ja osia Suora on äärettömän pitkä. A ja B ovat suoralla olevia pisteitä. Piste P on suoran ulkopuolella. Jana on geometriassa kahden pisteen välinen suoran osuus.

Lisätiedot

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan 1. a) Seoksen komponentit voidaan erotella toisistaan kromatografisilla menetelmillä. Mihin kromatografiset menetelmät perustuvat? (2p) Menetelmät perustuvat seoksen osasten erilaiseen sitoutumiseen paikallaan

Lisätiedot

Jahtipaikat.fi Käyttöohje

Jahtipaikat.fi Käyttöohje Jahtipaikat.fi Käyttöohje versio 2.0 Sisällysluettelo 1. Kirjautuminen...3 2. Näyttöruudun osat...3 3. Kartta-alusta...4 4. Kartan sisällön määrittely...4 5. Työkalut...5 5.1 Keskitä kartta koko Suomeen...5

Lisätiedot

Octo käyttöohje 1. Sisältö

Octo käyttöohje 1. Sisältö Octo käyttöohje 1 Sisältö Sisältö...1 Sisäänkirjautuminen...2 Etusivu...2 Uimarihaku...3 Uimariryhmät...4 Seurahaku...4 Kilpailutilastot...5 Ilmoittautuminen kilpailuun...6 Kilpailuun ilmoittautuminen...7

Lisätiedot

S-114.2500 Basics for Biosystems of the Cell Harjoitustyö. Proteiinirakenteen mallintaminen. Niina Sandholm 62938M Antti Niinikoski 60348E

S-114.2500 Basics for Biosystems of the Cell Harjoitustyö. Proteiinirakenteen mallintaminen. Niina Sandholm 62938M Antti Niinikoski 60348E S-114.2500 Basics for Biosystems of the Cell Harjoitustyö Proteiinirakenteen mallintaminen Niina Sandholm 62938M Antti Niinikoski 60348E Sisällysluettelo Johdanto... 3 Luonnontieteellinen perusta... 3

Lisätiedot

Laskuharjoitus 3 palautus 11. 11. 2003 mennessä. Entsyymillä on seuraavanlainen reaktiomekanismi (katso oheista kuvaa):

Laskuharjoitus 3 palautus 11. 11. 2003 mennessä. Entsyymillä on seuraavanlainen reaktiomekanismi (katso oheista kuvaa): Laskuharjoitus 3 palautus 11. 11. 2003 mennessä Tehtävä 1: Entsyymikinetiikkaa Entsyymillä on seuraavanlainen reaktiomekanismi (katso oheista kuvaa): 1. A:n sitoutuminen saa konformaatiossa aikaan muutoksen,

Lisätiedot

Luentoesimerkki: Riemannin integraali

Luentoesimerkki: Riemannin integraali Luentoesimerkki: Riemannin integraali Heikki Apiola, "New perpectives "-esitykseen lievästi muokattu Kurssi: Informaatioverkostot, keväällä Tässä (4..) käytetään "worksheet-modea", uudempaa "document mode"

Lisätiedot

Johdatus ohjelmointiin

Johdatus ohjelmointiin Johdatus ohjelmointiin EXAM tentin liitetiedostojen lataaminen, käyttäminen ja palauttaminen Kerro mahdolliset puutteet tai parannusehdotukset: pietari.heino@tut.fi Tällä sivulla on selitetty lyhyesti

Lisätiedot

RES - REAL ESTATE SYSTEM

RES - REAL ESTATE SYSTEM HUOLTOKIRJAN KÄYTTÖ Sivu 1/13 HELPPO KIINTEISTÖNHOITAJILLE RES - REAL ESTATE SYSTEM OUKA/ RES HUOLTOKIRJAN KÄYTTÖ Sivu 2/13 Ohjelmaan kirjaudutaan osoitteesta https://www.haahtela.fi Vinkki: luo pikakuvake

Lisätiedot

MAIDON PROTEIININ MÄÄRÄN SELVITTÄMINEN (OSA 1)

MAIDON PROTEIININ MÄÄRÄN SELVITTÄMINEN (OSA 1) MAIDON PROTEIININ MÄÄRÄN SELVITTÄMINEN (OSA 1) Johdanto Maito on tärkeä eläinproteiinin lähde monille ihmisille. Maidon laatu ja sen sisältämät proteiinit riippuvat useista tekijöistä ja esimerkiksi meijereiden

Lisätiedot

Anne-Mari Näsi 15.2.2010 EXCELIN PIKAKÄYTTÖOHJE (EXCEL 2007)

Anne-Mari Näsi 15.2.2010 EXCELIN PIKAKÄYTTÖOHJE (EXCEL 2007) Anne-Mari Näsi 15.2.2010 EXCELIN PIKAKÄYTTÖOHJE (EXCEL 2007) TAULUKON NIMEÄMINEN 1. Klikkaa hiiren kakkospainikkeella Taul1 eli taulukon nimen kohdalla. Valitse kohta Nimeä uudelleen. 2. Kirjoita taulukolle

Lisätiedot

Blogger-blogin käyttöönotto ja perusasiat Bloggerista & bloggauksesta

Blogger-blogin käyttöönotto ja perusasiat Bloggerista & bloggauksesta 1 Blogger-blogin käyttöönotto ja perusasiat Bloggerista & bloggauksesta Blogi on yhden tai useamman kirjoittajan verkkosivu tai -sivusto, jonka kautta voidaan julkaista omia kirjoituksia perinteisten julkaisukanavien

Lisätiedot

Aurinko. Tähtitieteen peruskurssi

Aurinko. Tähtitieteen peruskurssi Aurinko K E S K E I S E T K Ä S I T T E E T : A T M O S F Ä Ä R I, F O T O S F Ä Ä R I, K R O M O S F Ä Ä R I J A K O R O N A G R A N U L A A T I O J A A U R I N G O N P I L K U T P R O T U B E R A N S

Lisätiedot

Gimp alkeet XIII 9 luokan ATK-työt/HaJa Sivu 1 / 8. Tasot ja kanavat. Jynkänlahden koulu. Yleistä

Gimp alkeet XIII 9 luokan ATK-työt/HaJa Sivu 1 / 8. Tasot ja kanavat. Jynkänlahden koulu. Yleistä Gimp alkeet XIII 9 luokan ATK-työt/HaJa Sivu 1 / 8 Tasot ja kanavat Yleistä Tasot eli layerit ovat tärkeä osa nykyajan kuvankäsittelyä. Tasojen perusidea on se, että ne ovat läpinäkyviä "kalvoja", joita

Lisätiedot

Sivu 1 / 11 08.01.2013 Viikin kirjasto / Roni Rauramo

Sivu 1 / 11 08.01.2013 Viikin kirjasto / Roni Rauramo Sivu 1 / 11 Kuvien siirto kamerasta Lyhyesti Tämän oppaan avulla voit: - käyttää tietokoneen omaa automaattista kopiointiin tai siirtoon tarkoitettua toimintaa kuvien siirtoon kamerasta tai muistikortista

Lisätiedot

Trigonometriset funktiot 1/7 Sisältö ESITIEDOT: reaalifunktiot

Trigonometriset funktiot 1/7 Sisältö ESITIEDOT: reaalifunktiot Trigonometriset funktiot 1/7 Sisältö Trigonometriset funktiot suorakulmaisessa kolmiossa a c b Olkoon suorakulmaisen kolmion terävä kulma, a tämän vastainen kateetti, b viereinen kateetti ja c kolmion

Lisätiedot

1. Kalenterin omistajan käyttöohje

1. Kalenterin omistajan käyttöohje 1. Kalenterin omistajan käyttöohje 1.1. Kielen vaihtamien Ajanvarausjärjestelmässä kielen vaihtaminen tapahtuu painamalla sivun ylälaidassa olevia lippuja. 1.2. Kirjautuminen Kirjautumissivulla käyttäjä

Lisätiedot

Ohjelmistopohjaisen lisenssin käyttö

Ohjelmistopohjaisen lisenssin käyttö 24.11.15 rev. 2 Ohjelmistopohjaisen lisenssin käyttö Yleistä Mastercam on käyttänyt aina suojauspalikkaan sidottuja lisenssejä. Ne ovat suhteellisen helppokäyttöisiä ja lisenssin siirtämiseen ei tarvita

Lisätiedot

CEM DT-3353 Pihtimittari

CEM DT-3353 Pihtimittari CEM DT-3353 Pihtimittari Sivu 1/5 CEM DT-3353 Pihtimittari Ongelma Mittarin ohjelmisto ilmoittaa NO DATA vaikka tiedonsiirtokaapeli on kytketty tietokoneen ja mittarin välille, mittarissa on virta päällä

Lisätiedot

Tarkastele kuvaa, muistele matematiikan oppejasi, täytä tekstin aukot ja vastaa kysymyksiin.

Tarkastele kuvaa, muistele matematiikan oppejasi, täytä tekstin aukot ja vastaa kysymyksiin. 1. Pääryhmien ominaispiirteitä Tarkastele kuvaa, muistele matematiikan oppejasi, täytä tekstin aukot ja vastaa kysymyksiin. Merkitse aukkoihin mittakaavan tuttujen yksiköiden lyhenteet yksiköitä ovat metri,

Lisätiedot

Ohjeistus yhdistysten internetpäivittäjille

Ohjeistus yhdistysten internetpäivittäjille Ohjeistus yhdistysten internetpäivittäjille Oman yhdistyksen tietojen päivittäminen www.krell.fi-sivuille Huom! Tarvitset päivittämistä varten tunnukset, jotka saat ottamalla yhteyden Kristillisen Eläkeliiton

Lisätiedot

Näin teet oman tilin!

Näin teet oman tilin! Twitter Näin teet oman tilin! Mene osoitteeseen https://twitter.com/, missä uuden tilin luominen alkaa syöttämällä oma nimi, sähköpostiosoite (Tili pitää vahvistaa eli olemassa oleva osoite) sekä salasana.

Lisätiedot

PROJEKTISIVUJEN PAÄ IVITTAÄ MISEN OHJEET

PROJEKTISIVUJEN PAÄ IVITTAÄ MISEN OHJEET PROJEKTISIVUJEN PAÄ IVITTAÄ MISEN OHJEET Suomen partiolaiset Finlands scouter ry 04/2013, muokattu 02/2015 Tämä ohje on tarkoitettu Suomen Partiolaisten hallinnoimien projektisivustojen sisällöntuottajille

Lisätiedot

Johdanto... 3. Tavoitteet... 3. Työturvallisuus... 3. Polttokennoauton rakentaminen... 4. AURINKOPANEELITUTKIMUS - energiaa aurinkopaneelilla...

Johdanto... 3. Tavoitteet... 3. Työturvallisuus... 3. Polttokennoauton rakentaminen... 4. AURINKOPANEELITUTKIMUS - energiaa aurinkopaneelilla... OHJEKIRJA SISÄLLYS Johdanto... 3 Tavoitteet... 3 Työturvallisuus... 3 Polttokennoauton rakentaminen... 4 AURINKOPANEELITUTKIMUS - energiaa aurinkopaneelilla... 5 POLTTOKENNOAUTON TANKKAUS - polttoainetta

Lisätiedot

3.3 Paraabeli toisen asteen polynomifunktion kuvaajana. Toisen asteen epäyhtälö

3.3 Paraabeli toisen asteen polynomifunktion kuvaajana. Toisen asteen epäyhtälö 3.3 Paraabeli toisen asteen polynomifunktion kuvaajana. Toisen asteen epäyhtälö Yhtälön (tai funktion) y = a + b + c, missä a 0, kuvaaja ei ole suora, mutta ei ole yhtälökään ensimmäistä astetta. Funktioiden

Lisätiedot

MUOVIA MAIDOSTA. AVAINSANAT: Arkikemia Proteiinit Denaturoituminen Polymeerit Happamuus

MUOVIA MAIDOSTA. AVAINSANAT: Arkikemia Proteiinit Denaturoituminen Polymeerit Happamuus MUOVIA MAIDOSTA KOHDERYHMÄ: Työ voidaan tehdä kaikenikäisien kanssa. Teorian laajuus riippuu ryhmän tasosta/iästä. Alakoululaisille muovin valmistusta tehdessä puhutaan verkottumisesta ja muovin verkottuneesta

Lisätiedot

a. Mustan ja lyhytkarvaisen yksilön? b. Valkean ja pitkäkarvaisen yksilön? Perustele risteytyskaavion avulla.

a. Mustan ja lyhytkarvaisen yksilön? b. Valkean ja pitkäkarvaisen yksilön? Perustele risteytyskaavion avulla. 1. Banaanikärpänen dihybridiristeytys. Banaanikärpäsillä silmät voivat olla valkoiset (resessiivinen ominaisuus, alleeli v) tai punaiset (alleeli V). Toisessa kromosomissa oleva geeni määrittää siipien

Lisätiedot

Hakijalle: uudistetun verkkopalvelun käyttöohje 10/2010

Hakijalle: uudistetun verkkopalvelun käyttöohje 10/2010 Verkkopalvelun käyttöohje 10/2010 hakijalle 21.10.2010 v1.3 FI Hakijalle: uudistetun verkkopalvelun käyttöohje 10/2010 Käyttöohje on tarkoitettu Suomen Akatemian uudistetun verkkoasiointipalvelun käyttäjille.

Lisätiedot

SSH Secure Shell & SSH File Transfer

SSH Secure Shell & SSH File Transfer SSH Secure Shell & SSH File Transfer TIETOHALLINTO Janne Suvanto 1.9 2002 Sisällysluettelo Sisällysluettelo... 1 Yleistä... 2 SSH Secure Shell ohjelman asetukset... 3 POP3 tunnelin asetukset... 6 Yhteyden

Lisätiedot

Harjoitustehtäväkierros 1

Harjoitustehtäväkierros 1 T-06.50 kurssihenkilökunta deadline Tiistai 20.0.2009 2:5 Johdanto Tämä tehtäväkierros käsittelee pääasiassa toisen luennon sisältöä. Harjoituksia saa tehdä yksin tai yhdessä. Yhdessä tekeminen on suositeltavaa,

Lisätiedot

Uutiskirjesovelluksen käyttöohje

Uutiskirjesovelluksen käyttöohje Uutiskirjesovelluksen käyttöohje Käyttäjätuki: Suomen Golfpiste Oy Esterinportti 1 00240 HELSINKI Puhelin: (09) 1566 8800 Fax: (09) 1566 8801 E-mail: gp@golfpiste.com 2 Sisällys Johdanto... 1 Päänavigointi...

Lisätiedot

Syöpä. Ihmisen keho muodostuu miljardeista soluista. Vaikka. EGF-kasvutekijä. reseptori. tuma. dna

Syöpä. Ihmisen keho muodostuu miljardeista soluista. Vaikka. EGF-kasvutekijä. reseptori. tuma. dna Ihmisen keho muodostuu miljardeista soluista. Vaikka nämä solut ovat tietyssä mielessä meidän omiamme, ne polveutuvat itsenäisistä yksisoluisista elämänmuodoista, jotka ovat säilyttäneet monia itsenäisen

Lisätiedot

MATEMATIIKKA 3 VIIKKOTUNTIA

MATEMATIIKKA 3 VIIKKOTUNTIA EB-TUTKINTO 010 MATEMATIIKKA 3 VIIKKOTUNTIA PÄIVÄMÄÄRÄ: 4 kesäkuuta 010 KOKEEN KESTO: 3 tuntia (180 minuuttia) SALLITUT APUVÄLINEET: Eurooppa-koulun antama taulukkovihkonen Funktiolaskin, joka ei saa olla

Lisätiedot

Ohjeet asiakirjan lisäämiseen arkistoon

Ohjeet asiakirjan lisäämiseen arkistoon Ohjeet asiakirjan lisäämiseen arkistoon 1. Jos koneellesi ei vielä ole asennettu Open Office ohjelmaa, voit ladata sen linkistä joka löytyy Arkisto => Asiakirjapohjat sivulta seuran kotisivuilta. Jos ohjelma

Lisätiedot

- 4 aloituslaattaa pelaajien väreissä molemmille puolille on kuvattu vesialtaat, joista lähtee eri määrä akvedukteja.

- 4 aloituslaattaa pelaajien väreissä molemmille puolille on kuvattu vesialtaat, joista lähtee eri määrä akvedukteja. AQUA ROMANA Vesi oli elintärkeä ja keskeinen edellytys Rooman imperiumin kehitykselle. Vedensaannin turvaamiseksi taitavimmat rakennusmestarit rakensivat valtavan pitkiä akvedukteja, joita pidetään antiikin

Lisätiedot

sivu 1 Verkkopäätteen muuttaminen Anvian uuteen tekniikkaan Ohje käy seuraaviin verkkopäätteisiin

sivu 1 Verkkopäätteen muuttaminen Anvian uuteen tekniikkaan Ohje käy seuraaviin verkkopäätteisiin sivu 1 Verkkopäätteen muuttaminen Anvian uuteen tekniikkaan Ohje käy seuraaviin verkkopäätteisiin Zyxel Prestige 645 ISP Zyxel Prestige 645 WEB Zyxel Prestige 645R Zyxel Prestige 645 Ennen aloitusta tarkista,

Lisätiedot

Sen jälkeen Microsoft Office ja sen alta löytyy ohjelmat. Ensin käynnistä-valikosta kaikki ohjelmat

Sen jälkeen Microsoft Office ja sen alta löytyy ohjelmat. Ensin käynnistä-valikosta kaikki ohjelmat Microsoft Office 2010 löytyy tietokoneen käynnistävalikosta aivan kuin kaikki muutkin tietokoneelle asennetut ohjelmat. Microsoft kansion sisältä löytyy toimisto-ohjelmistopakettiin kuuluvat eri ohjelmat,

Lisätiedot

ELOKUVATYÖKALUN KÄYTTÖ ANIMAATION LEIKKAAMISESSA. Kun aloitetaan uusi projekti, on se ensimmäisenä syytä tallentaa.

ELOKUVATYÖKALUN KÄYTTÖ ANIMAATION LEIKKAAMISESSA. Kun aloitetaan uusi projekti, on se ensimmäisenä syytä tallentaa. ELOKUVATYÖKALUN KÄYTTÖ ANIMAATION LEIKKAAMISESSA Kun aloitetaan uusi projekti, on se ensimmäisenä syytä tallentaa. Projekti kannattaa tallentaa muutenkin aina sillöin tällöin, jos käy niin ikävästi että

Lisätiedot

Webforum. Version 14.4 uudet ominaisuudet. Viimeisin päivitys: 2014-12-6

Webforum. Version 14.4 uudet ominaisuudet. Viimeisin päivitys: 2014-12-6 Webforum Version 14.4 uudet ominaisuudet Viimeisin päivitys: 2014-12-6 Sisältö Tietoja tästä dokumentista... 3 Yleistä... 4 Yleistä & hallinnointi... 5 Dokumentit... 5 Perättäinen tarkistus- ja hyväksymisprosessi...

Lisätiedot

Muuta pohjan väri [ ffffff ] valkoinen Näytä suuri risti

Muuta pohjan väri [ ffffff ] valkoinen Näytä suuri risti 1. Qcad. Aloitusohjeita. Asenna ohjelma pakettien hallinasta. Tämä vapaa ohjelma on 2D. 3D ohjelma on maksullinen. Qcad piirustusohjelma avautuu kuvakkeesta. Oletuksena, musta pohja. On kuitenkin luontevaa

Lisätiedot

Proteiinien muuntuminen energiaksi ihmiselimistössä

Proteiinien muuntuminen energiaksi ihmiselimistössä Proteiinien muuntuminen energiaksi ihmiselimistössä Helsingin yliopisto Matemaattis-luonnontieteellinen tiedekunta Kemian laitos Kemian opettajankoulutusyksikkö Kandidaatintutkielma Tekijä: Klaus Sippel

Lisätiedot

OP-eTraderin käyttöopas

OP-eTraderin käyttöopas OP-eTraderin käyttöopas Tämä käyttöopas on lyhennetty versio virallisesta englanninkielisestä käyttöoppaasta, joka löytyy etrader - sovelluksen Help-valikosta tai painamalla sovelluksessa F1 -näppäintä.

Lisätiedot

SiMAP - lämmityksen ohjauskeskus. Contents

SiMAP - lämmityksen ohjauskeskus. Contents 1 (13) SiMAP - lämmityksen ohjauskeskus Contents 1. SiMAP SÄÄTÖ - sisäänkirjautuminen...2 2. T - Sensors, TC ja Trend...3 3. ASETUSARVON ASETTAMINEN - asuntojen lämpötila...6 4. MITTAUSNÄKYMÄ...7 4.1 Huoneistot...7

Lisätiedot

Perusopintojen Laboratoriotöiden Työselostus 1

Perusopintojen Laboratoriotöiden Työselostus 1 Perusopintojen Laboratoriotöiden Työselostus 1 Kalle Hyvönen Työ tehty 1. joulukuuta 008, Palautettu 30. tammikuuta 009 1 Assistentti: Mika Torkkeli Tiivistelmä Laboratoriossa tehdyssä ensimmäisessä kokeessa

Lisätiedot