Laskuharjoitus 2 vastauksia ja selityksiä

Koko: px
Aloita esitys sivulta:

Download "Laskuharjoitus 2 vastauksia ja selityksiä"

Transkriptio

1 Laskuharjoitus vastauksia ja selityksiä Selitykset ovat usein jonkin verran laajempia kuin vastaukseen edellytetyt, jotta asia selviäisi niillekin, jotka eivät sitä aluksi olleet keksineet. Tehtävä : Proteiinien ja hiilihydraattien perusasioita 0 8 p. A. Primäärirakenteesta ja muusta a) Kuinka monta erilaista 00 aminohapon polypeptidiketjua voidaan rakentaa 0 erilaisesta aminohaposta? Millaiset translaation jälkeiset modifikaatiot lisäävät entisestään mahdollisten erilaisten muotojen määrää? Koska peptidiketjulla on suunta eli aminohappo ei voi esiintyä ketjussa kumpaan suuntaan hyvänsä, on mahdollisuuksia 0 00, b) Jos geenissä on viisi eksonia, joista kukin koodaa n. 00 aminohapon kokoista domeenia, niin mitä mahdollisuuksia tuottaa geenistä erilaisia proteiineja edellisen kohdan vaihtelun lisäksi? Lisävaihtelua tuottaa se, että eksoneista vain osa voidaan lukea proteiiniksi. Proteiinia koodaava mrna voi siis olla yhdistelmä eri eksoneista ja näin ollen proteiinia voi sisältää eri domeeneja. c) Hiilihydraattikoodissa lisävariaatiota tuo mahdollisuus muodostaa erilaisia sidoksia eri monosakkaridien välillä ja näin ollen mahdollisuus tehdä haarautuneita ketjuja. Lasketaan yksinkertaistettu havainnollistava lasku. Ajattele, että sinulla on käytössäsi viittä erilaista molekyylejä, jotka voivat sitoutua toisiinsa neljän molekyylin molekyylin pituiseksi lineaariseksi ketjuksi, joka on toisesta päästään kiinnittynyt johonkin partikkeliin ja jossa molekyyleillä on suunta muodostaa sidoksia kolmella avaruudellisesti erilaisella ryhmällä (sidokset -, -, -, -, -, -, -, - ja - mahdollisia kahden molekyylin välillä) ja muodostaa näin ollen paitsi lineaarisia myös haaroittuneita ketjuja, jotka ovat samaten neljän molekyylin mittaisia ja yhdestä päästään kiinni jossakin partikkelissa. Kuinka monta erilaista lineaarista ketjua voit muodostaa tilanteissa ja? Kuinka monta ketjua voit kaikkiaan muodostaa tilanteessa, kun otat haaroittuneetkin huomioon? Hahmottele pieni joukko samasta monomeeristä rakentuvia, partikkeliin kiinnittyviä, mahdollisia ketjuja tilanteessa. Tilanne on samanlainen kuin olisi tapaus, jossa on vain viisi erilaista aminohappoa. Mahdollisuuksia on siis 5 4 =65. Tilanteessa on lineaarisia eli haarattomia ketjuja olemassa suurempi määrä. Ensimmäiseen alustaan sidottuun voi seuraava sitoutua kahdella eri tavalla. Samoin sitä seuraavaan jne.

2 Näin ollen on eri muotoisia haarautumattomia ketjuja **=8. Lisäksi jokainen palikka voi olla kolmessa eri asennossa ja palikoita on viittä erilaista, joten yhteensä mahdollisuuksia on 8* 4 *5 4 = Kun otetaan lisäksi huomioon haarautuneet, vaihtoehtojen määrä kasvaa entisestään. Yllä olevasta kuvasta nähdään, että kahdeksan eri muotoisen lineaarisen ketjun lisäksi on kaksi sellaista eri muotoista haarautunutta ketjua, joissa kaikki lähtevät ensimmäisestä palikasta joko vasemmalle tai oikealle eli sellaista, joissa alustaan kiinnittyneeseen palikkaan on kiinnittynyt suoraan vain yksi palikka. Lisäksi nähdään, että on sekä vasemmalle että oikealle kiinnityttäessä kaksi eri muotoista ketjua (sininen vaihtoehto ja punainen vaihtoehto) eli yhteensä neljä vaihtoehtoa, jos ensimmäiseen palikkaan kiinnittyy suoraan kaksi palikkaa. Näin ollen eri muotoisia ketjuja on yhteensä 8++4=4. Samoin kuin edellä saadaan erilaisten ketjujen kokonaismääräksi 4* 4 *5 4 = d) Minkä sokereiden biologisen tehtävän kannalta c-kohdassa havainnollistettu seikka on mitä ilmeisimmin hyödyllinen? Sokerit toimivat monissa kudoksissa ja solujen välisissä vuorovaikutuksissa tunnistesignaaleina. Toisessa tunnistuksen osapuolessa on tunnisteproteiinissa tiettyä sokeria sitova lektiinin kaltainen domeeni. Toisella osapuolella taas on sokeriryhmä. On tietenkin edullista, että ainakin toisia tunnistesignaaleja voidaan tehdä suuri määrä erilaisia pienestä määrästä erilaisia monomeerejä ja käyttämättä suurta määrää monomeerejä. B. Sekundääri- ja tertiäärirakenteesta a) Karboksipeptidaasi on n. 00 aminohappotähteen proteiini, joka on suunnilleen pallomainen (säde 5 Å). Miten monta aminohappoa voisi enintään olla pisimmässä mahdollisessa α-heeliksissä eli α- kierteessä? Entä β-laskoksessa? α-heeliksissä toistojakso,6 aminohappoa per kierros ja kierroksen pituus on 5,4 Å (eli 540 pm). Näin ollen on noustu matka,5 Å/aminohappo. 50 Å:n eli halkaisijan matkalle mahtuu siis enintään a aminohappoa, a,5 Å < 50 Å, a < 500/5,. a=. Pitkin proteiinin halkaisijaa kulkevaan α- heeliksiin mahtuisi siis aminohappoa. (Proteiinin pinnalle vähemmän, sillä α-heeliksi ei ole kovin taipuisa.) β-laskoksessa harjanteiden (/\/\/\) välinen etäisyys on kaksi aminohappoa ja n. 7 Å, joten aminohappojen välinen etäisyys on n.,5 Å ja siis suoraan β-laskokseen mahtuisi enintään b aminohappoa, b,5 Å < 50 Å, b < 500/5 4,, joten b=4. β-laskos voisi toki kiertyä ja kaartua jonkin verran ja jos laskisi β-käännökset osaksi β-laskosta, niin silloin vaikka koko proteiini voisi muodostua β-laskoksesta ja β-käännöksistä. b) Pienille laskostuneille proteiineille liuottimen kanssa kosketuksissa oleva pinta (solvent accessible surface area, joka kuvaa sitä, miten suuri on se pinta-ala, jolle (yleensä) vesimolekyyli voisi tunkeutua) on likimain suoraan verrannollinen tekijään M / ja laskostumattomille proteiineille puolestaan likimain suoraan verrannollinen tekijään M. M on kummassakin proteiinin massa. Selitä, mistä ero johtuu ja mitä se kertoo pienten proteiinien laskostumisesta.

3 Aminohappojen lukumäärä on likimain verrannollinen massaan. Siis laskostumattoman proteiinin jokseenkin avonaiselle ja satunnaiselle aminohappoketjulle on pinta-ala likimain yhden aminohapon pinta-ala kertaa aminohappojen lukumäärä. Koska aminohappjen lukumäärä N M ja koska A ketju =A ah N, on A M. Siispä laskostumaton ketju on avonainen. Jollekin säännöllisen muotoiselle kappaleelle puolestaan V k, A k ja L k, missä V on tilavuus, A pinta-ala, L yksiulotteinen etäisyys (esim. pituus, halkaisija tms.) ja k on mittakaava. Aminohappojen yhteistilavuus on suoraan verrannollinen massaan. Jos aminohapot ovat tiiviisti pakkautuneet proteiiniksi, on aminohappojen yhteistilavuus V ah V prot. Toisaalta jos pakkautumisen väliin jäävien tilojen määrä on suoraan verrannollinen tilavuuteen, on edelleen V prot V ah. Tällöin V prot M. Tällaiselle kappaleelle A V / M /. Koska liuottimelle altis pinta-ala kasvaisi, jos raot olisivat suuria, niin voidaan siis päätellä, että pienet proteiinit pakkautuvat likimain samanmuotoisiksi (jolloin likimain pallomainen rakenne vaikuttaa loogiselta) ja tiiviisti. c) Ns. Ramachandran plot tai Sasisekhran Ramakrishnan Ramachandran plot kuvaa peptidirungon sidosten sallittuja kulmia ja kulmia, joilla tietyt sekundäärirakenteet ovat mahdollisia. Tällainen kuvaaja voidaan piirtää myös eri aminohappotähteille erikseen (esimerkiksi laskemalla tietokonemallien avulla sallitut kulmat, joilla steeriset vuorovaikutukset eri asennoissa eivät ole liian epäedullisia). Miten tällaisissa kuvaajissa sallittujen kulmaparien osuus kaikista mahdollisista eroaisi alaniinin, valiinin ja glysiinin muodostamille ketjuille, kun niitä tarkastellaan suhteessa toisiinsa? Kaikilla aminohapoilla lukuun ottamatta proliiinia (joka oikeastaan onkin iminohappo) on samanlainen runko, joten erot johtuvat sivuketjuista. Valiinin sivuketju on -CH(-CH ), alaniinin -CH ja glysiinin vain -H. Valiinin suurin sivuketju rajoittaa eniten sallittujen kulmaparien määrää, glysiinille taasen sallittujen kulmaparien määrä on suurin, koska sen sivuketju on mitättömän pieni eli pelkkä vety. Alaniini sijoittuu näiden väliin. Tehtävä : Sekvenssistä kolmiulotteiseksi proteiiniksi tryptofaanisyntaasi 0 0 p. A. 40 vuotta sitten C. Yanofsky ym. tutkivat 960-luvulla aminohappovaihdosten vaikutusta entsyymiaktiviteettiin. Koesarjassa tutkittiin mutaatioiden vaikutusta E. coli -bakteerin tryptofaanisyntaasi-entsyymiin (Science 46:59 (964)). Sittemmin mutaatioiden vaikutuksiin perustava lähestymistapa on tullut yhdeksi keskeisimmistä solu- ja molekyylibiologian menetelmistä. Aminohappo sekvenssin kohdassa A vaihtui mutanteissa toiseksi aminohapoksi mm. seuraavasti: entsyymi aminohappo kohdassa A aktiivisuus wild type Gly täysi mutantti Glu puuttuu mutantti Arg puuttuu mutantti Ser täysi mutantti 4 Ala täysi mutantti 5 Val osittainen (wild type = luonnossa (pääasiallisesti) esiintyvä muoto) Tutkimuksen edetessä todettiin että muntanttientsyymeissä esiintyy aminohappovaihdoksia kohdan A lisäksi myös toisessa kohdassa. entsyymi aminohappo A aminohappo B aktiivisuus wild type Gly Tyr täysi mutantti Glu Tyr puuttuu mutantti 6 Glu Cys osittainen mutantti 7 Gly Cys puuttuu

4 Aikakauden tekniikalla pystyttiin selvittämään aminohappojen A ja B sijaitsevan peptidiketjussa 6 aminohapon päässä toisistaan. Riittävällä varmuudella voitiin osoittaa että muita aminohappovaihdoksia ei ole tapahtunut. Entsyymin koko aminohappojärjestys saatiin kuitenkin selville vasta joitakin vuosia myöhemmin. Muodosta tulosten perusteella hypoteesi aminohappojen A ja B merkityksestä entsyymin toiminnassa. Selitä mutantin 6 aktiivisuus mallisi perusteella. Vinkki: hae oppikirjasta esiin aminohappojen rakenteet. Oheiseen taulukkoon piirretty aminohappojen sivuketjut H glysiini tyrosiini WILD TYPE täysi aktiivisuus C O glutamaatti tyrosiini MUTANTTI ei aktiivisuutta

5 NH C NH NH arginiini tyrosiini MUTANTTI ei aktiivisuutta seriini tyrosiini MUTANTTI täysi aktiivisuus CH alaniini tyrosiini MUTANTTI 4 täysi aktiivisuus

6 CH CH CH valiini tyrosiini MUTANTTI 5 osittainen aktiivisuus C O SH glutamaatti kysteiini MUTANTTI 6 osittainen aktiivisuus H glysiini SH kysteiini MUTANTTI 7 ei aktiivisuutta Oheisesta taulukosta helposti nähdään, ettei sivuketjujen polaarisuus, vetysitoutuminen tai varaus vaikuta,esim. glysiinin substituutio sekä alaniiniksi että seriiniksi säilyttää aktiivisuuden ja toisaalta glysiinin substituutio suuriksi aminohapoiksi kuten positiivisesti varatuksi arginiiniksi, negatiivisesti varatuksi glutamaatiksi tai neutraaliksi valiiniksi heikentää aktiivisuutta. Tämän vahvistaa se, että paikan B aminohapon muuttuminen tyrosiinista pienimmäksi kysteiiniksi palauttaa osin aktiivisuutta mutantissa 6. Jos molemmat aminohapot ovat pieniä (mutantti 7), niin aktiivisuus menetetään. Mutanttien perusteella looginen hypoteesi on, että aminohapot A ja B sijaitsevat entsyymin aktiivisessa kohdassa ja että niiden yhteensä viemä tila on tärkein aktiivisuuteen vaikuttava tekijä, ts. jos molemmat ovat suuria, substraatti ei mahdu sitoutumaan ja jos molemmat ovat pieniä, on sitoutumistasku liian väljä, jotta substraatti orientoituisi oikein.

7 B. Uudet tuulet Ylläolevat tulokset pystyttiin todellisuudessa selittämään vasta vuosikymmeniä myöhemmin kun entsyymin kolmiulotteinen rakenne ratkaistiin. Tutki esim. Rasmol-ohjelmalla tryptofaanisyntaasin kiderakennetta. Aminohapot A ja B ovat ovat kyseisissä rakenteissa tyr75 ja gly. Tiedostossa BKS.PDB on wild-type entsyymin kiderakenne. Entsyymi on myös kiteytetty substraattianalogi indolipropanolifosfaatin (IPL) kanssa (tiedosto QOP.PDB). Tässä rakenteessa IPL molekyyli on sitoututuneena tryptofaanisyntaasin alfaketjun aktiiviseen kohtaan. Miten kiderakenteet muuttavat 960-luvulla tekemääsi hypoteesia? Ladataan Rasmol-ohjelmaan kiderakenne Protein Data Bankista (www.rcsb.org/pdb/). Valitaan esim. =>display=>ribbons. Kirjoitetaan komentoriville "select IPL" (enter) "spacefill" (enter) "colour orange" (enter), jolloin saadaan aktiivisessa kohdassa oleva substraattianalogi osoittamaan aktiivisen kohdan paikkaa: Valitaan nyt Gly ja Tyr75, jotta näemme, miten ne sijaitsevat suhteessa aktiiviseen kohtaan. Kirjoitetaan komentoriville "select Gly" (enter) "spacefill" (enter) "colour blue" (enter) "select Tyr75" (enter) "spacefill" (enter) "colour red" (enter). Nyt näemme, miten aminohapot A ja B sijaitsevat suhteessa aktiiviseen kohtaan. Aminohappo A eli tässä tapauksessa glysiini näkyy kuvassa sinisenä ja aminohappo B eli tyrosiini 75 punaisena. Substraatin sitoutumispaikkaa osoittava substraattianalogi näkyy kuvassa oranssina. Kuvan perusteella voidaan päätellä, että alkuperäinen hypoteesi on mitä todennäköisimmin oikea, sillä molemmat aminohapot ovat aktiivisessa kohdassa ja vieläpä aivan vierekkäin samalla puolella substraatin sitoutumispaikkaa ja lähikontaktissa substraattiin.....

8 ... C. Ovatko kaikki bakteerit samaa maata? Kiderakenteet ovat Salmonella typhimurium -bakteerin entsyymistä. Escherichia colin entsyymiä ei ole onnistuttu kiteyttämään eikä näin ollen tarkkaa tietoa kolmiulotteisesta rakenteesta ole. Tee tietokantoja käyttämällä sekvenssihaku ja tutki kuinka homologisia näiden kahden bakteerin tryptofaanisyntaasit ovat. Kuinka hyvin tämä homologia kuvaa kolmiulotteisen rakenteen samankaltaisuutta? Menemällä sivulle ja valitsemalla Swiss-Prot/TrEMBL-haku voidaan hakea Salmonella typhimuriumin tryptofaanisyntaasin α-ketjun sekvenssi. Valitaan oikeasta yläkulmasta Blastp-ajo. Ohjelma hakee lähisukuisia sekvenssejä ja vertailee niitä. Saadaan 78 %:n identiteetti E. colin sekvenssin kanssa, joka löytyy listalta. Painamalla kyseisestö ikkunasta align-linkkiä päästään sivulle, joka antaa seuraavat tulokset: CLUSTAL FORMAT for T-COFFEE Version_.7, CPU=0. sec, SCORE=870, Nseq=, Len=68 sp P0099 TRPA_SALTY MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD sp P0098 TRPA_ECOLI MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD *****.*****::*:**************************:*********:******** sp P0099 TRPA_SALTY GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ sp P0098 TRPA_ECOLI GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK *******.*********************:******************:*** ***:**: sp P0099 TRPA_SALTY VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS sp P0098 TRPA_ECOLI VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA ***************************:*****************:*************: sp P0099 TRPA_SALTY GVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKI sp P0098 TRPA_ECOLI GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI ********.****:**: *****:***.*******:*:**.**: ***************

9 sp P0099 TRPA_SALTY IEKNLASPKQMLAELRSFVSAMKAASRA sp P0098 TRPA_ECOLI IEQHINEPEKMLAALKVFVQPMKAATRS **:::.*::*** *: **..****:*: Nähdään, että sekvenssit ovat enimmäkseen samat, joten on syytä olettaa, että kolmiulotteiset rakenteet todennäköisesti vastaavat melko hyvin toisiaan. Huomautettakoon, että lisäksi tiedetään, että E. colin ja S. typhimuriumin entsyymin eri alayksiköt muodostavat keskenään toimivia kokonaisuuksia. Näin ollen vaikuttaa luultavalta, että rakenteellinen vastaavuus on ainakin meidän tehtävämme kannalta tarpeeksi hyvä. Tehtävä : Periferaalinen membraaniproteiini sytokromi c (cytochrome c) 0 8 p. Sytokromi c:n sekvenssiä voidaan käyttää lajien sukulaisuussuhteiden määrittämiseen (esim. Lehningeristä löydät kuvan), koska se on evolutiivisesti hyvin vanha proteiineja ja monissa sen sekvenssin aminohapoissa esiintyy vain vähän muuntelua eli ne ovat konservoituneita (conserved). Yleensä tällaisten aminohappojen ajatellaan olevan erityisen tärkeitä proteiinin rakenteen ja funktion kannalta. Sekvenssivertailuohjelmilla (esim. ClustalW) voidaan nähdä, miten ne sijoittuvat sekvenssissä. Havainnollisempaa on kuitenkin nähdä, miten ne sijoittuvat proteiiniin. Tämä onnistuu ConSurfin avulla, joka tarvitsee tunnetun proteiinirakenteen ja sen jälkeen itse tekee PSI-BLAST haun, jossa se etsii tunnetuista sekvensseistä 50 samankaltaisinta ja jonka perusteella se sitten puolestaan värittää tunnetun rakenteen aminohappotähteet sen mukaan, miten konservoituneita ne ovat. Käytä ConSurfissa (http://consurf.tau.ac.il/index.html) tunnettua rakennetta, jonka PDB-koodi on HRC. (Huom! Varmista, että koneella on Chime asennettuna, sillä tuloksien tarkasteluun käytettävä Protein Explorer tarvitsee sen toimiakseen. Ellei ole, sen saa imuroitua ilmaiseksi osoitteesta joskin rekisteröitymistä edellytetään.) Tuloksia tarkastellessasi kokeile myös toista katsontatapaa (hiiren oikea näppäin, Select Protein; hiiren oikea näppäin, Display Ribbons). Tämä katsontatapa helpottaa merkittävästi b- ja c-kohtia. a) Tälle proteiinille löydät pikaisestikin oppikirjaa selaamalla ja toisaalta PubMed-haun (http://www.ncbi.nih.gov/entrez/query.fcgi) avulla kaksi toisistaan poikkeavaa biologista toimintoa. Mitkä ne ovat? Mikä prosteettinen ryhmä proteiinin keskellä on? Sytokromi c toimii toisaalta elektroninsiirtäjänä elektroninsiirtoketju(i)ssa ja toisaalta toimii apoptoosin eli ohjelmoidun solukuoleman signaaliketjussa ja aktivoi ohjelmoidun solukuoleman prosesseja vapautuessaan mitokondrioista. Prosteettinen ryhmä proteiinin keskellä on hemi, joka koostuu porfyriinistä ja siihen koordinoidusta rautaionista. b) Miten konservoituneet ja muuttuvat aminohapot sijoittuvat proteiinin rakenteeseen? Liitä esim. kuva ja lyhyt sanallinen selostus tai pelkästään jälkimmäinen, jos kuvan liittämisessä ongelmia.

10

11 Katsomalla kuvia havaitaan, että suuri osa konservoituneista aminohapoista keskittyy prosteettisen ryhmän ympärillä ja toisaalta kyljelle, joka on lähellä prosteettista ryhmää. Vaikuttaa siis ilmeiseltä, että ne osallistuvat toiminnan kannalta keskeisiin prosesseihin, joihin vaaditaan prosteettista ryhmää ja toisaalta sen vuorovaikutusta ympäristön kanssa. c) Rakenteessa näkyy hajanaisesti konservoituneita aminohappoja muuallakin. Valitse hiiren oikealla näppäimellä Select Residue GLY. Valitse jälleen hiiren oikealla näppäimellä esim. Display Ball and stick ja kokeile myös Display Spacefill van der Waals radii. Millaisissa rakenteen kohdissa glysiinit näyttäisivät pääosin esiintyvän? Mikä voisi olla syynä siihen, että juuri glysiinit esiintyvät tällaisissa paikoissa? Oheisessa kuvassa glysiinit valittu ja asetettu ohjelma näyttämään ne spacifill-asetuksilla, jotta ne erottuvat muusta proteiinista. Havaitaan, että suuri osa glysiineistä sijaitsee äkillisissä käännöksissä. Syynä esiintymiseen tällaisissa paikoissa voisi olla se, että glysiinin sivuketju on pieni ja se pystyy esiintymään monissa eri kulmissa ilman sivuketjun aiheuttamia steerisiä esteitä (katso tehtävää ).

12 Tehtävä 4: Integraalinen membraaniproteiini akvaporiini (aquaporin, aquaporin-chip) 0 0 p. Tänä vuonna toinen kemian alan Nobel-palkinnon saajista eli Peter Agre sai palkintonsa akvaporiinien löytämisestä. Ainakin Ruotsin Kuninkaallinen Tiedeakatemia siis ilmeisesti piti moista oivana tekona, joten tutustukaamme siihen, mistä oikein on kysymys. A) Akvaporiinien toiminnasta a) Selitä lyhyesti, mitä akvaporiinit tekevät (nimestäkin sen jo arvaa). Akvaporiinit ovat kanavia, jotka päästävät selektiivisesti (lähinnä) vettä lävitseen. b) Selitä lyhyesti, mikä määrää (netto)kulkusuunnan akvaporiinimolekyylin läpi. Akvaporiini on kanava eikä pumppu, joten kulkusuunnan määrää veden aktiivisuus kalvon eri puolilla (/ osmoottinen paine / vapaan veden pitoisuus). c) Selitä lyhyesti, miten akvaporiinit liittyvät munuaisten toimintaan ja miksi siis niillä saattaisi olla merkitystä esim. lääketieteen kannalta. Jos päädyt tekemään hakuja verkossa, voit käyttää hakuja tehdessäsi esim. joitakin hakusanoista hakusanoja ADH, aquaporin, vasopressin, renal, fluid retention. Akvaporiinit osallistuvat munuaissoluissa vesivirtojen säätelyyn. Laimeaa primäärivirtsaa syntyy vuorokaudessa lähes 00 litraa. Suurin osa sen vedestä imeytyy takaisin elimistöön. Muutenkin munuaisen toiminnan kannalta keskeistä on konsentraatiogradienttien synnyttäminen, mikä puolestaan edellyttää munuaisen eri osien erilaista vedenläpäisevyyttä, mikä on mahdollista akvaporiinien ansiosta. Tärkeä on rooli akvaporiinilla on myös kokoojaputkissa, joissa akvaporiini- siirtyy antidiureettisen hormonin vaikutuksesta solun sisällä olevista kalvorakkuloista solukalvoon, jolloin vedenläpäisevyys kasvaa ja enemmän vettä imeytyy takaisin. Akvaporiini on siis keskeinen elimistön nestetasapainon säätelyssä. Nestetasapainoon vaikuttaminen on puolestaan keskeistä esim. sydämen vajaatoiminnassa ja toisinaan myös verenpaineen hoidossa (ns. nesteenpoistolääkkeet lienevät monille tuttuja).

13 B) Akvaporiinin sekvenssistä a) Hae Swiss-Protin (http://us.expasy.org/sprot/) avulla naudan (Bos taurus) aquaporin-chipsekvenssi. Syötä hakutuloksesi BLASTiin (klikkaa hakutulossivun alalaidasta "BLAST submission on ExPASy/SIB"). Millaisia proteiineja löydät hakutuloksiesi joukosta? Ohjelmalle antamaasi sekvenssiä muistuttavia proteiineja löytynee sekä samasta eliöstä että muista eliöistä. Mitä tämä kertoo proteiinien kehittymisestä menneiden aikojen kuluessa? Klikkaa hakutulosten kuvamuotoisen esitystavan ylälaidassa olevaa Pfam-valikkoa, josta saat lisätietoja proteiiniperheestä. Entä miten proteiinien evoluutio ja sukupuu muuttuisi mielenkiintoisemmaksi ja monimutkaisemmaksi, jos kyseessä olisi proteiini, jolla on monta domeenia? (Vastataksesi tähän selvitä itsellesi, mikä on domeenin määritelmä ja mitkä ovat sille tyypillisiä piirteitä suhteessa geenien eksoneihin ja toimintoihin.) Läheisimmät sukulaiset ovat akvaporiinin samaa isomuotoa eri lajeilta ja kaukaisempina sukulaisina löytyy akvaporiinin eri isomuotoja samalta ja muilta lajeilta. Toisaalta tämä tietysti kertoo sen, että funktiot ovat erilaistuneet ennen lajien erkaantumista. Lisäksi nähdään myös se, että proteiinit paitsi muuttuvat mutaatioiden tuloksena, niiden geeni voi myös kahdentua ja alkaa erilaistua eri proteiiniksi/isomuodoksi (jolla on myös erilaistuneet toiminnot). Monet eri domeenit muuttaisivat tilannetta siten, että domeeneilla olisi oma kehityshistoriansa. Yhden domeenin sukulaisia saattaisia esiintyä monissa eri proteiineissa, joiden muut domeenit eivät olisi samalla tavalla sukua keskenään. b) Ota muistiin naudan sekvenssin nimi. Elät toistaiseksi menneisyydessä ja haluat selvitellä sekvenssin perusteella joitakin alkeellisia tietoja proteiinien rakenteesta eli transmembraaniheeliksien määrää. Tässä apuna toimiin Stephen Whiten laboratorion Membrane Protein Explorer (http://blanco.biomol.uci.edu/mpex/). Kokeile ohjelmalla hieman eri hydropaattisuusasteikkoja (avautuvan Java-ikkunan oikealla puolella. Montako transmembraaniheeliksiä ohjelma ennustaa akvaporiinilla olevan? Selitä muutamin sanoin myös se periaate, johon tuollainen ennustus yleensä perustuu. Nähdään ohjelman ennustavan kuusi transmembraaniheeliksiä oletusasetuksilla. Tällaiset ennusteet perustuvat siihen, että ohjelmat etsivät erilaisiin hydrofobisuusasteikkoihin perustuen

14 aminohapposekvenssistä jaksoja, joissa olisi tarpeeksi pitkä jakso (9 0) aminohappoja transmembraaniheeliksiä varten. C) Akvaporiinin rakenteesta Onneksi naudan akvaporiinin rakenne on saatu jo selvitettyä. Sen PDB-koodi on J4N. Imuroi tiedosto Protein Data Bank -palvelusta (http://www.rcsb.org/pdb/). Tarkastele rakennetta esimerkiksi Rasmolin tai Chimen avulla (jälkimmäisessä tapauksessa avaa tiedosto selainohjelmaan, joka osaa Chime plugin -ohjelman avulla avata pdb-tiedoston). a) Väritä proteiinin hydrofiiliset/polaariset ja toisaalta hydrofobiset aminohapot eri väreillä. Onko tuloksessa mitään järkeä? Minkä mielenkiintoisen seikan huomaat membraanin uppoutuneiden heeliksien lukumäärän ja rakenteen suhteen (vertaa Bb-kohdassa saamiisi ennusteisiin)? Havaitaan, että polaariset aminohapot ovat enimmäkseen proteiinin muodostaman kanavan sisäpinnalla ja kalvon läp kulkevan osan ulkopuolella, kun taas kalvon läpäisevän osan lipideitä kohti suuntautuvat aminohapot ovat enimmäkseen hydrofobisia. Tuloksessa on mitä ilmeisimmin järkeä, sillä polaariset aminohapot ovat niitä, jotka ovat kontaktissa veden kanssa ja hydrofobiset niitä, jotka ovat kontaktissa lipidien rasvahappoketjujen kanssa. Nähdään, että varsinaisia transmembraaniheeliksejä on seitsemän. Lisäksi nähdään, että rakenteessa esiintyy yksi kahdesta lyhyestä heeliksistä muodostuva transmembraanijakso, jota transmembraaniennustusohjelman ei oikein voisikaan olettaa löytävän, koska se etsii yhtenäisiä jaksoja, jotka ovat tarpeeksi pitkiä.

15 b) Tee sille samanlainen temppu kuin tehtävässä eli väritetä se ConSurf-ohjelman avulla aminohappojen konservoituneisuuden mukaan. Millaisen tuloksen sait ja miksi se oikeastaan oli odotettu, siis miksei mikä hyvänsä polaarinen aminohappo kelpaa konservoituneen alueen tilalle? Nähdään, että konservoituneet aminohapot ovat keskittyneet kanavan sisään. Tämä oli odotettavissa, koska kanavan täytyy toimia siten, että se päästää pelkästään vettä lävitseen, muttei muita polaarisia yhdisteitä kuten H O + :aa. Näin ollen mikä tahansa polaarinen aminohappo ei kelpaa kanavan sisälle, vaan niiden täytyy olla juuri sellaisia, että ne takaavat tuon selektion. Siksi aminohappovaihdokset kanavan sisällä johtaisivat todennäköisemmin toimimattomaan proteiiniin ja mutaation karsiutumiseen luonnonvalinnassa. Näin ollen juuri kanavan sisäosa on konservoitunut.

Bioteknologian tutkinto-ohjelma Valintakoe Tehtävä 3 Pisteet / 30

Bioteknologian tutkinto-ohjelma Valintakoe Tehtävä 3 Pisteet / 30 Tampereen yliopisto Bioteknologian tutkinto-ohjelma Valintakoe 21.5.2015 Henkilötunnus - Sukunimi Etunimet Tehtävä 3 Pisteet / 30 3. a) Alla on lyhyt jakso dsdna:ta, joka koodaa muutaman aminohappotähteen

Lisätiedot

Henkilötunnus - Biokemian/bioteknologian valintakoe. Sukunimi Etunimet Tehtävä 1 Pisteet / 20

Henkilötunnus - Biokemian/bioteknologian valintakoe. Sukunimi Etunimet Tehtävä 1 Pisteet / 20 elsingin yliopisto/tampereen yliopisto enkilötunnus - Biokemian/bioteknologian valintakoe Sukunimi 24. 5. 2004 Etunimet Tehtävä 1 Pisteet / 20 Solujen kalvorakenteet rajaavat solut niiden ulkoisesta ympäristöstä

Lisätiedot

VASTAUS 1: Yhdistä oikein

VASTAUS 1: Yhdistä oikein KPL3 VASTAUS 1: Yhdistä oikein a) haploidi - V) ihmisen sukusolu b) diploidi - IV) ihmisen somaattinen solu c) polyploidi - VI) 5n d) iturata - III) sukusolujen muodostama solulinja sukupolvesta toiseen

Lisätiedot

Kuukauden kuvat kerhon galleriaan 1.4.2016 lähtien kuukaudenkuvaajan kuvagalleria on siirretty uudelle palvelimelle osoitteeseen:

Kuukauden kuvat kerhon galleriaan 1.4.2016 lähtien kuukaudenkuvaajan kuvagalleria on siirretty uudelle palvelimelle osoitteeseen: Kuukauden kuvat kerhon galleriaan 1.4.2016 lähtien kuukaudenkuvaajan kuvagalleria on siirretty uudelle palvelimelle osoitteeseen: http://www.kamera73.fi/kuukaudenkuvaaja Kukin seuran jäsen voi laittaa

Lisätiedot

DNA RNA proteiinit transkriptio prosessointi translaatio regulaatio

DNA RNA proteiinit transkriptio prosessointi translaatio regulaatio CELL 411-- replikaatio repair mitoosi meioosi fertilisaatio rekombinaatio repair mendelistinen genetiikka DNA-huusholli Geenien toiminta molekyyligenetiikka DNA RNA proteiinit transkriptio prosessointi

Lisätiedot

zotero www.zotero.org

zotero www.zotero.org zotero www.zotero.org Viitteidenhallintajärjestelmä Zotero toimii Firefox-selaimessa. Muita ilmaisia viitteidenhallintajärjestelmiä ovat esimerkiksi EndNote ja Mendeley. Näissä ohjeissa on kuvataan Zoteron

Lisätiedot

,QWHUQHWVHODLPHQNl\WWlPLQHQ±,QWHUQHW([SORUHU

,QWHUQHWVHODLPHQNl\WWlPLQHQ±,QWHUQHW([SORUHU ,QWHUQHWVHODLPHQNl\WWlPLQHQ±,QWHUQHW([SORUHU Tässä pääsette tutustumaan Internet Explorerin (IE) käyttöön. Muitakin selainversioita löytyy, kuten esimerkiksi Netscape, Opera ja Mozilla. Näiden muiden selainten

Lisätiedot

KÄYTTÖOHJE. Servia. S solutions

KÄYTTÖOHJE. Servia. S solutions KÄYTTÖOHJE Servia S solutions Versio 1.0 Servia S solutions Servia Finland Oy PL 1188 (Microkatu 1) 70211 KUOPIO puh. (017) 441 2780 info@servia.fi www.servia.fi 2001 2004 Servia Finland Oy. Kaikki oikeudet

Lisätiedot

Sivu 1 / 11 08.01.2013 Viikin kirjasto / Roni Rauramo

Sivu 1 / 11 08.01.2013 Viikin kirjasto / Roni Rauramo Sivu 1 / 11 Kuvien siirto kamerasta Lyhyesti Tämän oppaan avulla voit: - käyttää tietokoneen omaa automaattista kopiointiin tai siirtoon tarkoitettua toimintaa kuvien siirtoon kamerasta tai muistikortista

Lisätiedot

Epooqin perusominaisuudet

Epooqin perusominaisuudet Epooqin perusominaisuudet Huom! Epooqia käytettäessä on suositeltavaa käyttää Firefox -selainta. Chrome toimii myös, mutta eräissä asioissa, kuten äänittämisessä, voi esiintyä ongelmia. Internet Exploreria

Lisätiedot

MAB3 - Harjoitustehtävien ratkaisut:

MAB3 - Harjoitustehtävien ratkaisut: MAB - Harjoitustehtävien ratkaisut: Funktio. Piirretään koordinaatistoakselit ja sijoitetaan pisteet:. a) Funktioiden nollakohdat löydetään etsimällä kuvaajien ja - akselin leikkauspisteitä. Funktiolla

Lisätiedot

3. Kuvio taitetaan kuutioksi. Mikä on suurin samaa kärkeä ympäröivillä kolmella sivutahkolla olevien lukujen tulo?

3. Kuvio taitetaan kuutioksi. Mikä on suurin samaa kärkeä ympäröivillä kolmella sivutahkolla olevien lukujen tulo? Peruskoulun matematiikkakilpailu Loppukilpailu perjantaina 4.2.2011 OSA 1 Ratkaisuaika 30 min Pistemäärä 20 Tässä osassa ei käytetä laskinta. Esitä myös lasku, kuvio, päätelmä tai muu lyhyt perustelu.

Lisätiedot

Molekyyli- ja solubiologia ELEC-2210 Proteiinit

Molekyyli- ja solubiologia ELEC-2210 Proteiinit Molekyyli- ja solubiologia ELEC-2210 Proteiinit Vuento & Heino: Biokemian ja solubiologian perusteet, ss. 51-66 Alberts et al. Essential Cell Biology, 4. p, luku 4 Dos. Tuomas Haltia, HY, Biotieteiden

Lisätiedot

Ohjeet asiakirjan lisäämiseen arkistoon

Ohjeet asiakirjan lisäämiseen arkistoon Ohjeet asiakirjan lisäämiseen arkistoon 1. Jos koneellesi ei vielä ole asennettu Open Office ohjelmaa, voit ladata sen linkistä joka löytyy Arkisto => Asiakirjapohjat sivulta seuran kotisivuilta. Jos ohjelma

Lisätiedot

Tervetuloa HK Shop:in käyttäjäksi!

Tervetuloa HK Shop:in käyttäjäksi! Tervetuloa HK Shop:in käyttäjäksi! HK Shop on HKSCAN FINLANDin reaaliaikainen tilausjärjestelmä, missä voit mm. tutkia tuotetietoja ja -valikoimaa, tehdä tilauksia, saada tilaushetken tuotesaatavuustiedon

Lisätiedot

ENTSYYMIKATA- LYYSIN PERUSTEET (dos. Tuomas Haltia)

ENTSYYMIKATA- LYYSIN PERUSTEET (dos. Tuomas Haltia) ENTSYYMIKATA- LYYSIN PERUSTEET (dos. Tuomas Haltia) Elämän edellytykset: Solun täytyy pystyä (a) replikoitumaan (B) katalysoimaan tarvitsemiaan reaktioita tehokkaasti ja selektiivisesti eli sillä on oltava

Lisätiedot

A* Reitinhaku Aloittelijoille

A* Reitinhaku Aloittelijoille A* Reitinhaku Aloittelijoille Alkuperäisen artikkelin kirjoittanut Patrick Lester, suomentanut Antti Veräjänkorva. Suom. huom. Tätä kääntäessäni olen pyrkinyt pitämään saman alkuperäisen tyylin ja kerronnan.

Lisätiedot

KÄYTTÖOHJE LATOMO VERSO

KÄYTTÖOHJE LATOMO VERSO Kirjautuminen Kirjatuminen järjestelmään tapahtuu syöttämällä ylläpitäjältä (yleensä sähköpostilla) saatu käyttäjätunnus ja salasana niille varattuihin kenttiin. Jos olet unohtanut salasanasi voit syöttää

Lisätiedot

KEMIA. Kemia on tiede joka tutkii aineen koostumuksia, ominaisuuksia ja muuttumista.

KEMIA. Kemia on tiede joka tutkii aineen koostumuksia, ominaisuuksia ja muuttumista. KEMIA Kemia on tiede joka tutkii aineen koostumuksia, ominaisuuksia ja muuttumista. Kemian työturvallisuudesta -Kemian tunneilla tutustutaan aineiden ominaisuuksiin Jotkin aineet syttyvät palamaan reagoidessaan

Lisätiedot

Jahtipaikat.fi Käyttöohje

Jahtipaikat.fi Käyttöohje Jahtipaikat.fi Käyttöohje versio 2.0 Sisällysluettelo 1. Kirjautuminen...3 2. Näyttöruudun osat...3 3. Kartta-alusta...4 4. Kartan sisällön määrittely...4 5. Työkalut...5 5.1 Keskitä kartta koko Suomeen...5

Lisätiedot

Matematiikan tukikurssi

Matematiikan tukikurssi Matematiikan tukikurssi Kurssikerta 8 Väliarvolause Oletetaan, että funktio f on jatkuva jollain reaalilukuvälillä [a, b] ja derivoituva avoimella välillä (a, b). Funktion muutos tällä välillä on luonnollisesti

Lisätiedot

Johdatus ohjelmointiin

Johdatus ohjelmointiin Johdatus ohjelmointiin EXAM tentin liitetiedostojen lataaminen, käyttäminen ja palauttaminen Kerro mahdolliset puutteet tai parannusehdotukset: pietari.heino@tut.fi Tällä sivulla on selitetty lyhyesti

Lisätiedot

Königsbergin sillat. Königsberg 1700-luvulla. Leonhard Euler ( )

Königsbergin sillat. Königsberg 1700-luvulla. Leonhard Euler ( ) Königsbergin sillat 1700-luvun Königsbergin (nykyisen Kaliningradin) läpi virtasi joki, jonka ylitti seitsemän siltaa. Sanotaan, että kaupungin asukkaat yrittivät löytää reittiä, joka lähtisi heidän kotoaan,

Lisätiedot

SALIBANDYN PALVELUSIVUSTO Ohje pelaajasiirron tekemiseen

SALIBANDYN PALVELUSIVUSTO Ohje pelaajasiirron tekemiseen PELAAJASIIRTOJEN OHJE VERSIO 1.4. PÄIVITETTY 23.6.2015 s. 1 SALIBANDYN PALVELUSIVUSTO Ohje pelaajasiirron tekemiseen Huom! Tässä ohjeessa kerromme kuinka siirto tehdään vapaalla siirtoajalla, jolloin vanhan

Lisätiedot

keskenään isomorfiset? (Perustele!) Ratkaisu. Ovat. Tämän näkee indeksoimalla kärjet kuvan osoittamalla tavalla: a 1 b 3 a 5

keskenään isomorfiset? (Perustele!) Ratkaisu. Ovat. Tämän näkee indeksoimalla kärjet kuvan osoittamalla tavalla: a 1 b 3 a 5 Johdatus diskreettiin matematiikkaan Harjoitus 6, 21.10.2015 1. Ovatko verkot keskenään isomorfiset? (Perustele!) Ratkaisu. Ovat. Tämän näkee indeksoimalla kärjet kuvan osoittamalla tavalla: a 2 b 4 a

Lisätiedot

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan 1. a) Mitä tarkoitetaan biopolymeerilla? Mihin kolmeen ryhmään biopolymeerit voidaan jakaa? (1,5 p) Biopolymeerit ovat luonnossa esiintyviä / elävien solujen muodostamia polymeerejä / makromolekyylejä.

Lisätiedot

S Laskennallinen systeemibiologia

S Laskennallinen systeemibiologia S-114.2510 Laskennallinen systeemibiologia 3. Harjoitus 1. Koska tilanne on Hardy-Weinbergin tasapainossa luonnonvalintaa lukuunottamatta, saadaan alleeleista muodostuvien eri tsygoottien genotyyppifrekvenssit

Lisätiedot

Materiaalifysiikan perusteet P Ratkaisut 1, Kevät 2017

Materiaalifysiikan perusteet P Ratkaisut 1, Kevät 2017 Materiaalifysiikan perusteet 51104P Ratkaisut 1, Kevät 017 1. Kiderakenteen alkeiskopin hahmottamiseksi pyritään löytämään kuvitteellisesta rakenteesta sen pienin toistuva yksikkö (=kanta). Kunkin toistuvan

Lisätiedot

Matemaatiikan tukikurssi

Matemaatiikan tukikurssi Matemaatiikan tukikurssi Kurssikerta 1 1 Funktiot Funktion määritelmä Funktio on sääntö, joka liittää kahden eri joukon alkioita toisiinsa. Ollakseen funktio tämän säännön on liitettävä jokaiseen lähtöjoukon

Lisätiedot

Ohjelmistopohjaisen lisenssin käyttö

Ohjelmistopohjaisen lisenssin käyttö 24.11.15 rev. 2 Ohjelmistopohjaisen lisenssin käyttö Yleistä Mastercam on käyttänyt aina suojauspalikkaan sidottuja lisenssejä. Ne ovat suhteellisen helppokäyttöisiä ja lisenssin siirtämiseen ei tarvita

Lisätiedot

Matematiikan tukikurssi

Matematiikan tukikurssi Matematiikan tukikurssi Kurssikerta 1 Määrittelyjoukoista Tarkastellaan funktiota, jonka määrittelevä yhtälö on f(x) = x. Jos funktion lähtöjoukoksi määrittelee vaikkapa suljetun välin [0, 1], on funktio

Lisätiedot

Kenguru 2015 Mini-Ecolier (2. ja 3. luokka) RATKAISUT

Kenguru 2015 Mini-Ecolier (2. ja 3. luokka) RATKAISUT sivu 1 / 10 3 pistettä 1. Kuinka monta pilkkua kuvan leppäkertuilla on yhteensä? (A) 17 (B) 18 (C) 19 (D) 20 (E) 21 Ratkaisu: Pilkkuja on 1 + 1 + 1 + 2 + 2 + 1 + 3 + 2 + 3 + 3 = 19. 2. Miltä kuvan pyöreä

Lisätiedot

Matematiikan tukikurssi

Matematiikan tukikurssi Matematiikan tukikurssi Kurssikerta 10 1 Funktion monotonisuus Derivoituva funktio f on aidosti kasvava, jos sen derivaatta on positiivinen eli jos f (x) > 0. Funktio on aidosti vähenevä jos sen derivaatta

Lisätiedot

Suvi Junes/Pauliina Munter Tietohallinto/Opetusteknologiapalvelut 2014

Suvi Junes/Pauliina Munter Tietohallinto/Opetusteknologiapalvelut 2014 Tietokanta Tietokanta on työkalu, jolla opettaja ja opiskelijat voivat julkaista tiedostoja, tekstejä, kuvia ja linkkejä alueella. Opettaja määrittelee lomakkeen muotoon kentät, joiden kautta opiskelijat

Lisätiedot

Käyttöohje. Energent MagiCAD plugin

Käyttöohje. Energent MagiCAD plugin Käyttöohje Energent MagiCAD plugin Sisältö 1. Yleistä 1 Dokumentin sisältö... 1 Ohjelman asennus... 1 Vaadittavat ohjelmistot... 1 Asennus... 1 Ohjelman käynnistys... 2 2. Toiminnallisuudet 3 Insert Energent

Lisätiedot

MATEMATIIKKA 3 VIIKKOTUNTIA

MATEMATIIKKA 3 VIIKKOTUNTIA EB-TUTKINTO 010 MATEMATIIKKA 3 VIIKKOTUNTIA PÄIVÄMÄÄRÄ: 4 kesäkuuta 010 KOKEEN KESTO: 3 tuntia (180 minuuttia) SALLITUT APUVÄLINEET: Eurooppa-koulun antama taulukkovihkonen Funktiolaskin, joka ei saa olla

Lisätiedot

2. Seuraavassa kuvassa on verkon solmujen topologinen järjestys: x t v q z u s y w r. Kuva 1: Tehtävän 2 solmut järjestettynä topologisesti.

2. Seuraavassa kuvassa on verkon solmujen topologinen järjestys: x t v q z u s y w r. Kuva 1: Tehtävän 2 solmut järjestettynä topologisesti. Tietorakenteet, laskuharjoitus 11, ratkaisuja 1. Leveyssuuntaisen läpikäynnin voi toteuttaa rekursiivisesti käsittelemällä jokaisella rekursiivisella kutsulla kaikki tietyllä tasolla olevat solmut. Rekursiivinen

Lisätiedot

Vektorien pistetulo on aina reaaliluku. Esimerkiksi vektorien v = (3, 2, 0) ja w = (1, 2, 3) pistetulo on

Vektorien pistetulo on aina reaaliluku. Esimerkiksi vektorien v = (3, 2, 0) ja w = (1, 2, 3) pistetulo on 13 Pistetulo Avaruuksissa R 2 ja R 3 on totuttu puhumaan vektorien pituuksista ja vektoreiden välisistä kulmista. Kuten tavallista, näiden käsitteiden yleistäminen korkeampiulotteisiin avaruuksiin ei onnistu

Lisätiedot

Matematiikan tukikurssi, kurssikerta 3

Matematiikan tukikurssi, kurssikerta 3 Matematiikan tukikurssi, kurssikerta 3 1 Epäyhtälöitä Aivan aluksi lienee syytä esittää luvun itseisarvon määritelmä: { x kun x 0 x = x kun x < 0 Siispä esimerkiksi 10 = 10 ja 10 = 10. Seuraavaksi listaus

Lisätiedot

Kangasniemen yrityshakemisto KÄYTTÖOHJE YRITTÄJÄLLE. KANGASNIEMEN KUNTA yrityshakemisto.kangasniemi.fi

Kangasniemen yrityshakemisto KÄYTTÖOHJE YRITTÄJÄLLE. KANGASNIEMEN KUNTA yrityshakemisto.kangasniemi.fi 2015 Kangasniemen yrityshakemisto KÄYTTÖOHJE YRITTÄJÄLLE KANGASNIEMEN KUNTA yrityshakemisto.kangasniemi.fi 1 Sisällysluettelo 1. Sivustolle rekisteröityminen... 2 2. Yrityksen lisääminen... 3 2.1. Yritystiedot...

Lisätiedot

Injektio. Funktiota sanotaan injektioksi, mikäli lähtöjoukon eri alkiot kuvautuvat maalijoukon eri alkioille. Esim.

Injektio. Funktiota sanotaan injektioksi, mikäli lähtöjoukon eri alkiot kuvautuvat maalijoukon eri alkioille. Esim. Injektio Funktiota sanotaan injektioksi, mikäli lähtöjoukon eri alkiot kuvautuvat maalijoukon eri alkioille. Esim. Funktio f on siis injektio mikäli ehdosta f (x 1 ) = f (x 2 ) seuraa, että x 1 = x 2.

Lisätiedot

verkkojen G ja H välinen isomorfismi. Nyt kuvaus f on bijektio, joka säilyttää kyseisissä verkoissa esiintyvät särmät, joten pari

verkkojen G ja H välinen isomorfismi. Nyt kuvaus f on bijektio, joka säilyttää kyseisissä verkoissa esiintyvät särmät, joten pari Tehtävä 9 : 1 Merkitään kirjaimella G tehtäväpaperin kuvan vasemmanpuoleista verkkoa sekä kirjaimella H tehtäväpaperin kuvan oikeanpuoleista verkkoa. Kuvan perusteella voidaan havaita, että verkko G on

Lisätiedot

Proteiinien kontaktiresidyjen ennustaminen. Tuomo Hartonen Teoreettisen fysiikan syventävien opintojen seminaari

Proteiinien kontaktiresidyjen ennustaminen. Tuomo Hartonen Teoreettisen fysiikan syventävien opintojen seminaari Proteiinien kontaktiresidyjen ennustaminen Tuomo Hartonen Teoreettisen fysiikan syventävien opintojen seminaari 13.12.12 Terminologiaa Aminohappo = proteiinien rakennuspalikka, luonto käyttää 20 erilaista

Lisätiedot

ROMUMETALLIA OSTAMASSA (OSA 1)

ROMUMETALLIA OSTAMASSA (OSA 1) ROMUMETALLIA OSTAMASSA (OSA 1) Johdanto Kupari on metalli, jota käytetään esimerkiksi sähköjohtojen, tietokoneiden ja putkiston valmistamisessa. Korkean kysynnän vuoksi kupari on melko kallista. Kuparipitoisen

Lisätiedot

Matematiikan peruskurssi 2

Matematiikan peruskurssi 2 Matematiikan peruskurssi Tentti, 9..06 Tentin kesto: h. Sallitut apuvälineet: kaavakokoelma ja laskin, joka ei kykene graaseen/symboliseen laskentaan Vastaa seuraavista viidestä tehtävästä neljään. Saat

Lisätiedot

Luku 8. Aluekyselyt. 8.1 Summataulukko

Luku 8. Aluekyselyt. 8.1 Summataulukko Luku 8 Aluekyselyt Aluekysely on tiettyä taulukon väliä koskeva kysely. Tyypillisiä aluekyselyitä ovat, mikä on taulukon välin lukujen summa tai pienin luku välillä. Esimerkiksi seuraavassa taulukossa

Lisätiedot

Oulun seitsemäsluokkalaisten matematiikkakilpailu 18.1.2012 Tehtävät ja ratkaisut

Oulun seitsemäsluokkalaisten matematiikkakilpailu 18.1.2012 Tehtävät ja ratkaisut Oulun seitsemäsluokkalaisten matematiikkakilpailu 18.1.2012 Tehtävät ja ratkaisut (1) Kolmen peräkkäisen kokonaisluvun summa on 42. Luvuista keskimmäinen on a) 13 b) 14 c) 15 d) 16. Ratkaisu. Jos luvut

Lisätiedot

Kannan vektorit siis virittävät aliavaruuden, ja lisäksi kanta on vapaa. Lauseesta 7.6 saadaan seuraava hyvin käyttökelpoinen tulos:

Kannan vektorit siis virittävät aliavaruuden, ja lisäksi kanta on vapaa. Lauseesta 7.6 saadaan seuraava hyvin käyttökelpoinen tulos: 8 Kanta Tässä luvussa tarkastellaan aliavaruuden virittäjävektoreita, jotka muodostavat lineaarisesti riippumattoman jonon. Merkintöjen helpottamiseksi oletetaan luvussa koko ajan, että W on vektoreiden

Lisätiedot

OP-eTraderin käyttöopas

OP-eTraderin käyttöopas OP-eTraderin käyttöopas Tämä käyttöopas on lyhennetty versio virallisesta englanninkielisestä käyttöoppaasta, joka löytyy etrader - sovelluksen Help-valikosta tai painamalla sovelluksessa F1 -näppäintä.

Lisätiedot

Kaksinkäsin.fi - ohjeet varaamiseen

Kaksinkäsin.fi - ohjeet varaamiseen Kaksinkäsin.fi - ohjeet varaamiseen 27.2.2017 Yleiset ohjeet Kaksinkäsin.fi sivujen yläreunassa on valikko, josta pääsee suoraan useisiin tässä ohjeessa viitattuihin alisivuihin. Kun olet kirjautuneena

Lisätiedot

Tehtävä 1 2 3 4 5 6 7 Vastaus

Tehtävä 1 2 3 4 5 6 7 Vastaus Kenguru Benjamin, vastauslomake Nimi Luokka/Ryhmä Pisteet Kenguruloikka Irrota tämä vastauslomake tehtävämonisteesta. Merkitse tehtävän numeron alle valitsemasi vastausvaihtoehto. Jätä ruutu tyhjäksi,

Lisätiedot

Sonera Viestintäpalvelu VIP

Sonera Viestintäpalvelu VIP Sonera Viestintäpalvelu VIP Poissaolotiedotetoiminnallisuuden käyttöopas 1 (8) Sonera Viestintäpalvelu VIP - poissaolotiedotetoiminnallisuus Toiminnallisuuden kuvaus Poissaolotiedotteen aktivoit päälle

Lisätiedot

+ 3 2 5 } {{ } + 2 2 2 5 2. 2 kertaa jotain

+ 3 2 5 } {{ } + 2 2 2 5 2. 2 kertaa jotain Jaollisuustestejä (matematiikan mestariluokka, 7.11.2009, ohjattujen harjoitusten lopputuloslappu) Huom! Nämä eivät tietenkään ole ainoita jaollisuussääntöjä; ovatpahan vain hyödyllisiä ja ainakin osittain

Lisätiedot

Tutkimusmateriaalit -ja välineet: kaarnan palaset, hiekan murut, pihlajanmarjat, juuripalat, pakasterasioita, vettä, suolaa ja porkkananpaloja.

Tutkimusmateriaalit -ja välineet: kaarnan palaset, hiekan murut, pihlajanmarjat, juuripalat, pakasterasioita, vettä, suolaa ja porkkananpaloja. JIPPO-POLKU Jippo-polku sisältää kokeellisia tutkimustehtäviä toteutettavaksi perusopetuksessa, kerhossa tai kotona. Polun tehtävät on tarkoitettu suoritettavaksi luonnossa joko koulun tai kerhon lähimaastossa,

Lisätiedot

Matematiikan taito 9, RATKAISUT. , jolloin. . Vast. ]0,2] arvot.

Matematiikan taito 9, RATKAISUT. , jolloin. . Vast. ]0,2] arvot. 7 Sovelluksia 90 a) Koska sin saa kaikki välillä [,] olevat arvot, niin funktion f ( ) = sin pienin arvo on = ja suurin arvo on ( ) = b) Koska sin saa kaikki välillä [0,] olevat arvot, niin funktion f

Lisätiedot

Yhtälönratkaisusta. Johanna Rämö, Helsingin yliopisto. 22. syyskuuta 2014

Yhtälönratkaisusta. Johanna Rämö, Helsingin yliopisto. 22. syyskuuta 2014 Yhtälönratkaisusta Johanna Rämö, Helsingin yliopisto 22. syyskuuta 2014 Yhtälönratkaisu on koulusta tuttua, mutta usein sitä tehdään mekaanisesti sen kummempia ajattelematta. Jotta pystytään ratkaisemaan

Lisätiedot

Avaa sovellus (PERUSAURORA)

Avaa sovellus (PERUSAURORA) 23.12.2010. Päivitetty 12.01.2011. Täydennetty 01.02.2011 Kaarina Karjalainen 1 Tehdyn numeron kopioiminen omalle osastolle Tämä on ohje numeroiden kopioimista varattaville/lainattaville lehdille. Pääsääntönä

Lisätiedot

Johtuuko tämä ilmastonmuutoksesta? - kasvihuoneilmiön voimistuminen vaikutus sääolojen vaihteluun

Johtuuko tämä ilmastonmuutoksesta? - kasvihuoneilmiön voimistuminen vaikutus sääolojen vaihteluun Johtuuko tämä ilmastonmuutoksesta? - kasvihuoneilmiön voimistuminen vaikutus sääolojen vaihteluun Jouni Räisänen Helsingin yliopiston fysiikan laitos 15.1.2010 Vuorokauden keskilämpötila Talvi 2007-2008

Lisätiedot

1.9 Harjoituksia. Frekvenssijakaumien harjoituksia. MAB5: Tilastotieteen lähtökohdat. a) Kaikki aakkoset b) Kirjaimet L, E, M, C, B, A ja i.

1.9 Harjoituksia. Frekvenssijakaumien harjoituksia. MAB5: Tilastotieteen lähtökohdat. a) Kaikki aakkoset b) Kirjaimet L, E, M, C, B, A ja i. MAB5: Tilastotieteen lähtökohdat 1.9 Harjoituksia 1.1 Ulkolämpömittari näytti eilen 10 C ja tänään 20 C. Onko tänään kaksi kertaa niin kylmä kuin eilen? Miksi tai miksi ei? 1.2 Minkä luokkien muuttujia

Lisätiedot

Mikäli huomaat virheen tai on kysyttävää liittyen malleihin, lähetä viesti osoitteeseen

Mikäli huomaat virheen tai on kysyttävää liittyen malleihin, lähetä viesti osoitteeseen Mikäli huomaat virheen tai on kysyttävää liittyen malleihin, lähetä viesti osoitteeseen anton.mallasto@aalto.fi. 1. 2. Muista. Ryhmän G aliryhmä H on normaali aliryhmä, jos ah = Ha kaikilla a G. Toisin

Lisätiedot

Opetustapahtumien hakeminen (Hae - Opetustapahtuma)

Opetustapahtumien hakeminen (Hae - Opetustapahtuma) Helsingin yliopisto WinOodi 1 (5) Opetustapahtumien hakeminen (Hae - Opetustapahtuma) Opetustapahtumien hakua tarvitaan sekä opetustapahtumien käsittelyssä että raporttien tulostamisessa. Ohjeessa käsitellään

Lisätiedot

Valitse vain kuusi tehtävää! Tee etusivun yläreunaan pisteytysruudukko! Kaikkiin tehtäviin tarvittavat välivaiheet esille!

Valitse vain kuusi tehtävää! Tee etusivun yläreunaan pisteytysruudukko! Kaikkiin tehtäviin tarvittavat välivaiheet esille! 5.4.013 Jussi Tyni 1. Selitä ja piirrä seuraavat lyhyesti: a) Kehäkulma ja keskikulma b) Todista, että kolmion kulmien summa on 180 astetta. Selitä päätelmiesi perustelut.. a) Suorakulmaisen kolmion kateetit

Lisätiedot

Radan luominen OCad llä

Radan luominen OCad llä Radan luominen OCad llä 1. Avataan ratojen suunnittelu menemällä ensiksi ohjelmistopalkin yläreunaan Tiedosto-kohtaan ja alavetovalikosta valikoidaan Uusi -kohta. Valinta hyväksytään hiiren vasemman puoleista

Lisätiedot

MP3-RADIO USB/SD/MMC -AUTORADION KÄYTTÖOPAS

MP3-RADIO USB/SD/MMC -AUTORADION KÄYTTÖOPAS ROCK POP EQ CLAS RDM AUTORADIO FINwww.facebook.com/denverelectronics MP3-RADIO USB/SD/MMC -AUTORADION KÄYTTÖOPAS CAU-436 1 17 11 18 7 6 12 16 CAU-436 FM/USB/SD MP3 PLAYER 14 15 TA PTY 8 VOL/SEL AF 2 19

Lisätiedot

Kirkkopalvelut Office365, Opiskelijan ohje 1 / 17 IT Juha Nalli 22.12.2015

Kirkkopalvelut Office365, Opiskelijan ohje 1 / 17 IT Juha Nalli 22.12.2015 Kirkkopalvelut Office365, Opiskelijan ohje 1 / 17 Oppilaat saavat vuoden 2016 alusta käyttöönsä oppilaitoksen sähköpostin ja muita palveluita Microsoftin Office365:sta. Oppilaiden sähköposti on muotoa

Lisätiedot

Y ja

Y ja 1 Funktiot ja raja-arvot Y100 27.10.2008 ja 29.10.2008 Aki Hagelin aki.hagelin@helsinki.fi Department of Psychology / Cognitive Science University of Helsinki 2 Funktiot (Lue Häsä & Kortesharju sivut 4-9)

Lisätiedot

Ohjelmoinnin peruskurssi Y1

Ohjelmoinnin peruskurssi Y1 Ohjelmoinnin peruskurssi Y1 CSE-A1111 30.9.2015 CSE-A1111 Ohjelmoinnin peruskurssi Y1 30.9.2015 1 / 27 Mahdollisuus antaa luentopalautetta Goblinissa vasemmassa reunassa olevassa valikossa on valinta Luentopalaute.

Lisätiedot

Vaihdoitko puhelinta? Yhteystietojen siirto Lumian, iphonen ja Androidin välillä käy näin

Vaihdoitko puhelinta? Yhteystietojen siirto Lumian, iphonen ja Androidin välillä käy näin Vaihdoitko puhelinta? Yhteystietojen siirto Lumian, iphonen ja Androidin välillä käy näin Tekniikka 11.10.2015 10:45 Olavi Koistinen, Helsingin Sanomat Yhteystietojen siirto Androidista iphoneen kuin Gmail-käyttäjätunnus.

Lisätiedot

Matematiikan tukikurssi, kurssikerta 2

Matematiikan tukikurssi, kurssikerta 2 Matematiikan tukikurssi kurssikerta 1 Relaatioista Oletetaan kaksi alkiota a ja b. Näistä kumpikin kuuluu johonkin tiettyyn joukkoon mahdollisesti ne kuuluvat eri joukkoihin; merkitään a A ja b B. Voidaan

Lisätiedot

5.6 Yhdistetty kuvaus

5.6 Yhdistetty kuvaus 5.6 Yhdistetty kuvaus Määritelmä 5.6.1. Oletetaan, että f : æ Y ja g : Y æ Z ovat kuvauksia. Yhdistetty kuvaus g f : æ Z määritellään asettamalla kaikilla x œ. (g f)(x) =g(f(x)) Huomaa, että yhdistetty

Lisätiedot

Murtolukujen peruslaskutoimitukset Cuisenairen lukusauvoilla

Murtolukujen peruslaskutoimitukset Cuisenairen lukusauvoilla Murtolukujen peruslaskutoimitukset Cuisenairen lukusauvoilla 1. Tehtävänanto Pohdi kuinka opettaisit yläasteen oppilaille murtolukujen peruslaskutoimitukset { +, -, *, / } Cuisenairen lukusauvoja apuna

Lisätiedot

MATEMATIIKKA 3 VIIKKOTUNTIA. PÄIVÄMÄÄRÄ: 8. kesäkuuta 2009

MATEMATIIKKA 3 VIIKKOTUNTIA. PÄIVÄMÄÄRÄ: 8. kesäkuuta 2009 EB-TUTKINTO 2009 MATEMATIIKKA 3 VIIKKOTUNTIA PÄIVÄMÄÄRÄ: 8. kesäkuuta 2009 KOKEEN KESTO: 3 tuntia (180 minuuttia) SALLITUT APUVÄLINEET: Eurooppa-koulun antama taulukkovihkonen Funktiolaskin, joka ei saa

Lisätiedot

3. Laajakaistaliittymän asetukset / Windows XP

3. Laajakaistaliittymän asetukset / Windows XP 3. Laajakaistaliittymän asetukset / Windows XP 3.1 Laajakaistaliittymän asetusten tarkistus / Windows XP Seuraavien ohjeiden avulla tarkistat Windows XP -käyttöjärjestelmien asetukset ja luot Internet-yhteyden.

Lisätiedot

Webmail on monipuolinen työkalu jolla voi tehdä paljon muutakin kuin lukea sähköpostia. Tässä ohjeessa on lyhyesti esitelty joitakin sen ominaisuuksia. Peruspostilaatikossa ei ole kaikkia ominaisuuksia,

Lisätiedot

Hgin kaupungin opetusvirasto Wilma opas huoltajille 1(10) HAKE/Tiepa 28.2.2007 KKa

Hgin kaupungin opetusvirasto Wilma opas huoltajille 1(10) HAKE/Tiepa 28.2.2007 KKa Hgin kaupungin opetusvirasto Wilma opas huoltajille 1(10) :LOPD 0LNl:LOPDRQ" Wilma on internetin kautta toimiva liittymä opettajille, oppilaille ja näiden huoltajille. Se ei ole käyttäjän koneella oleva

Lisätiedot

7A.2 Ylihienosilppouma

7A.2 Ylihienosilppouma 7A.2 Ylihienosilppouma Vetyatomin perustilan kentän fotoni on λ 0 = 91,12670537 nm, jonka taajuus on f o = 3,289841949. 10 15 1/s. Tämä spektriviiva on kaksoisviiva, joiden ero on taajuuksina mitattuna

Lisätiedot

VAASAN YLIOPISTO TEKNILLINEN TIEDEKUNTA SÄHKÖTEKNIIKKA. Lauri Karppi j82095. SATE.2010 Dynaaminen kenttäteoria DIPOLIRYHMÄANTENNI.

VAASAN YLIOPISTO TEKNILLINEN TIEDEKUNTA SÄHKÖTEKNIIKKA. Lauri Karppi j82095. SATE.2010 Dynaaminen kenttäteoria DIPOLIRYHMÄANTENNI. VAASAN YLIOPISTO TEKNILLINEN TIEDEKUNTA SÄHKÖTEKNIIKKA Oskari Uitto i78966 Lauri Karppi j82095 SATE.2010 Dynaaminen kenttäteoria DIPOLIRYHMÄANTENNI Sivumäärä: 14 Jätetty tarkastettavaksi: 25.02.2008 Työn

Lisätiedot

Nettiposti. Nettiposti käyttöohje

Nettiposti. Nettiposti käyttöohje YKSIKÄÄN ASIAKAS EI OLE MEILLE LIIAN PIENI TAI MIKÄÄN HAASTE LIIAN SUURI. Nettiposti Nettiposti käyttöohje Tässä käyttöohjeessa kuvataan selainkäyttöisen Nettiposti sähköpostiohjelman toiminnot. Käyttöohje

Lisätiedot

DMP / Kevät 2016 / Mallit Harjoitus 6 / viikko 13 / alkuviikko

DMP / Kevät 2016 / Mallit Harjoitus 6 / viikko 13 / alkuviikko DMP / Kevät 2016 / Mallit Harjoitus 6 / viikko 13 / alkuviikko Alkuviikon tuntitehtävä 1: Montako kahdeksaan yhtäsuureen sektoriin leikattua pitsaa voidaan tehdä kolmesta täytteestä siten, että kukin sektori

Lisätiedot

Ristitulolle saadaan toinen muistisääntö determinantin avulla. Vektoreiden v ja w ristitulo saadaan laskemalla determinantti

Ristitulolle saadaan toinen muistisääntö determinantin avulla. Vektoreiden v ja w ristitulo saadaan laskemalla determinantti 14 Ristitulo Avaruuden R 3 vektoreille voidaan määritellä pistetulon lisäksi niin kutsuttu ristitulo. Pistetulosta poiketen ristitulon tulos ei ole reaaliluku vaan avaruuden R 3 vektori. Ristitulosta on

Lisätiedot

TALLENNETAAN MUISTITIKULLE JA MUISTIKORTILLE

TALLENNETAAN MUISTITIKULLE JA MUISTIKORTILLE TALLENNETAAN MUISTITIKULLE JA MUISTIKORTILLE HERVANNAN KIRJASTON TIETOTORI Insinöörinkatu 38 33720 Tampere 040 800 7805 tietotori.hervanta@tampere.fi TALLENNETAAN MUISTIKULLE JA MUISTIKORTILLE 1 Muistitikun

Lisätiedot

T Luonnollisten kielten tilastollinen käsittely Vastaukset 11, ke , 12:15 14:00 Puheentunnistus ja kielimallien evaluointi Versio 1.

T Luonnollisten kielten tilastollinen käsittely Vastaukset 11, ke , 12:15 14:00 Puheentunnistus ja kielimallien evaluointi Versio 1. T-61.020 Luonnollisten kielten tilastollinen käsittely Vastaukset 11, ke 18.4.2007, 12:1 14:00 Puheentunnistus ja kielimallien evaluointi Versio 1.0 1. Käytämme siis jälleen viterbi-algoritmia todennäköisimmän

Lisätiedot

Opetustapahtumien hakeminen (Hae - Opetustapahtuma)

Opetustapahtumien hakeminen (Hae - Opetustapahtuma) Helsingin yliopisto WinOodi Sivu 1/5 Opetustapahtumien hakeminen (Hae - Opetustapahtuma) Opetustapahtumien hakua tarvitaan sekä opetustapahtumien käsittelyssä että raporttien tulostamisessa. Ohjeessa käsitellään

Lisätiedot

Lauseen erikoistapaus on ollut kevään 2001 ylioppilaskirjoitusten pitkän matematiikan kokeessa seuraavassa muodossa:

Lauseen erikoistapaus on ollut kevään 2001 ylioppilaskirjoitusten pitkän matematiikan kokeessa seuraavassa muodossa: Simo K. Kivelä, 13.7.004 Frégier'n lause Toisen asteen käyrillä ellipseillä, paraabeleilla, hyperbeleillä ja niiden erikoistapauksilla on melkoinen määrä yksinkertaisia säännöllisyysominaisuuksia. Eräs

Lisätiedot

UpdateIT 2010: Uutisten päivitys

UpdateIT 2010: Uutisten päivitys UpdateIT 2010: Uutisten päivitys Käyttäjätuki: Suomen Golfpiste Oy Esterinportti 1 00240 HELSINKI Puhelin: (09) 1566 8800 Fax: (09) 1566 8801 E-mail: gp@golfpiste.com 2 Sisällys Uutisen lisääminen... 1

Lisätiedot

Etunimi. Sukunimi. Oppimistavoite: ymmärtää, kuinka positiiviset ja negatiiviset magneettiset navat tuottavat työntö- ja vetovoimaa.

Etunimi. Sukunimi. Oppimistavoite: ymmärtää, kuinka positiiviset ja negatiiviset magneettiset navat tuottavat työntö- ja vetovoimaa. 1 Magneettiset navat Oppimistavoite: ymmärtää, kuinka positiiviset ja negatiiviset magneettiset navat tuottavat työntö- ja vetovoimaa. 1. Nimeä viisi esinettä, joihin magneetti kiinnittyy. 2. Mitä magneetin

Lisätiedot

dt 2. Nämä voimat siis kumoavat toisensa, jolloin saadaan differentiaaliyhtälö

dt 2. Nämä voimat siis kumoavat toisensa, jolloin saadaan differentiaaliyhtälö Mathematican version 8 mukainen. (25.10.2012 SKK) Tavallinen heiluri Otetaan tarkastelun kohteeksi tavallinen yksinkertainen heiluri. Tämä koostuu kitkattomaan niveleen kiinnitetystä (massattomasta) varresta

Lisätiedot

ψ(x) = A cos(kx) + B sin(kx). (2) k = nπ a. (3) E = n 2 π2 2 2ma 2 n2 E 0. (4)

ψ(x) = A cos(kx) + B sin(kx). (2) k = nπ a. (3) E = n 2 π2 2 2ma 2 n2 E 0. (4) 76A KIINTEÄN AINEEN FYSIIKKA Ratkaisut 4 Kevät 214 1. Tehtävä: Yksinkertainen malli kovalenttiselle sidokselle: a) Äärimmäisen yksinkertaistettuna mallina elektronille atomissa voidaan pitää syvää potentiaalikuoppaa

Lisätiedot

Ohjeita opetukseen ja odotettavissa olevat tulokset

Ohjeita opetukseen ja odotettavissa olevat tulokset Ohjeita opetukseen ja odotettavissa olevat tulokset Ensimmäinen sivu on työskentelyyn orientoiva johdatteluvaihe, jossa annetaan jotain tietoja ongelmista, joita happamat sateet aiheuttavat. Lisäksi esitetään

Lisätiedot

4757 4h. MAGNEETTIKENTÄT

4757 4h. MAGNEETTIKENTÄT TURUN AMMATTIKORKEAKOULU TYÖOHJE 1/7 FYSIIKAN LABORATORIO V 1.6 5.014 4757 4h. MAGNEETTIKENTÄT TYÖN TAVOITE Työssä tutkitaan vitajohtimen aiheuttamaa magneettikentää. VIRTAJOHTIMEN SYNNYTTÄMÄ MAGNEETTIKENTTÄ

Lisätiedot

Tuplaturvan tilaus ja asennusohje

Tuplaturvan tilaus ja asennusohje Tuplaturvan tilaus ja asennusohje 1. Kirjaudu lähiverkkokauppaan omilla tunnuksillasi tai luo itsellesi käyttäjätunnus rekisteröitymällä Lähiverkkokaupan käyttäjäksi. a. Käyttäjätunnus on aina sähköpostiosoitteesi.

Lisätiedot

Integrointi ja sovellukset

Integrointi ja sovellukset Integrointi ja sovellukset Tehtävät:. Muodosta ja laske yläsumma funktiolle fx) x 5 välillä [, 4], kun väli on jaettu neljään yhtä suureen osaan.. Määritä integraalin x + ) dx likiarvo laskemalla alasumma,

Lisätiedot

niin järjestys on tämä: ensin kerto- ja jakolaskut vasemmalta oikealle, sen jälkeen plus- ja miinuslaskut vasemmalta oikealle.

niin järjestys on tämä: ensin kerto- ja jakolaskut vasemmalta oikealle, sen jälkeen plus- ja miinuslaskut vasemmalta oikealle. Alkeistason matikkaa Plus-, miinus-, kerto- ja jakolaskujen laskujärjestys Esim. jos pitää laskea tällainen lasku:? niin järjestys on tämä: ensin kerto- ja jakolaskut vasemmalta oikealle, sen jälkeen plus-

Lisätiedot

CINAHL(EBSCO) käyttöohjeita (10/2010)

CINAHL(EBSCO) käyttöohjeita (10/2010) CINAHL(EBSCO) käyttöohjeita (10/2010) Sisältö 1. Katkaisumerkki, sanojen yhdistely, fraasihaku... - 1-2. Advanced Search haku vapailla hakusanoilla... - 1-3. Haku asiasanoilla (CINAHL Headings)... - 2-4.

Lisätiedot

6*. MURTOFUNKTION INTEGROINTI

6*. MURTOFUNKTION INTEGROINTI MAA0 6*. MURTOFUNKTION INTEGROINTI Murtofunktio tarkoittaa kahden polynomin osamäärää, ja sen yleinen muoto on P() R : R(). Q() Mikäli osoittajapolynomin asteluku on nimittäjäpolynomin astelukua korkeampi

Lisätiedot

Tehtävä 2: Loppuosataulukko

Tehtävä 2: Loppuosataulukko Tehtävä 2: Loppuosataulukko Tutustu tarkoin seuraavaan tekstiin ja vastaa sitä hyväksi käyttäen tehtävän loppuosassa esitettyihin viiteen kysymykseen. Annetun merkkijonon (ns. hahmo) esiintymän haku pidemmästä

Lisätiedot

Kennelliiton Omakoira-jäsenpalvelu Ohje Kennelpiireille, osoitelistat

Kennelliiton Omakoira-jäsenpalvelu Ohje Kennelpiireille, osoitelistat Kennelliiton Omakoira-jäsenpalvelu Ohje Kennelpiireille, osoitelistat 1.2.2016 2(10) Osoitelistat Osoitteet-valinnan näkyminen kennelpiirin henkilöille... 3 Tietojen haku listaukselle... 3 Yhdistykset,

Lisätiedot

Kuva 1. Jokaisen tavallisen kuvan tasotyökalussa näkyy vain yksi taso, tässä nimellä tausta.

Kuva 1. Jokaisen tavallisen kuvan tasotyökalussa näkyy vain yksi taso, tässä nimellä tausta. Gimp alkeet XII 9 luokan ATK-työt/HaJa Sivu 1 / 6 GIMP:in tasotyökalu Lue ensin nämä ohjeet! Harjoitus lopussa! GIMP:in tasotyökalu on nimensä mukaisesti työkalu, jolla hallitaan tasoja, niiden läpinäkyvyyttä,

Lisätiedot

Perusopintojen Laboratoriotöiden Työselostus 1

Perusopintojen Laboratoriotöiden Työselostus 1 Perusopintojen Laboratoriotöiden Työselostus 1 Kalle Hyvönen Työ tehty 1. joulukuuta 008, Palautettu 30. tammikuuta 009 1 Assistentti: Mika Torkkeli Tiivistelmä Laboratoriossa tehdyssä ensimmäisessä kokeessa

Lisätiedot