Vastasyntyneiden aineenvaihduntasairauksien laajentuva seulonta Suomessa

Koko: px
Aloita esitys sivulta:

Download "Vastasyntyneiden aineenvaihduntasairauksien laajentuva seulonta Suomessa"

Transkriptio

1 Vastasyntyneiden aineenvaihduntasairauksien laajentuva seulonta Suomessa Ilkka Mononen professori, kliininen kemia, Turun yliopisto johtava ylilääkäri, TYKS-SAPA-liikelaitos SASKE, johtaja

2 Vastasyntyneiden aineenvaihduntasairaudet Eräissä synnynnäisissä aineenvaihduntasairauksissa nopea hoito voi estää lapsen kuoleman, kehitysvammaisuuden tai muita vakavia seurauksia Lapset näyttävät usein vastasyntyneinä terveiltä vakavasta taudista huolimatta Sairaudet voidaan todeta seulontatutkimuksella muutamasta imupaperille otetusta veritipasta 2-5 vrk:n iässä Hoitona usein erikoisruokavalio tai hormonihoito

3 Vastasyntyneiden aineenvaihduntasairauksien seulonta maailmalla Maailmalla yleistä Laajimmissa seulonnoissa tutkitaan yli 40 sairautta Tanskassa, Norjassa ja Ruotsissa kansallinen seulonta Suomi poikkeus seulotaan vain yhtä sairautta kilpirauhasen vajaatoimintaa napaverinäytteestä. Huhtikuussa 2014 julkaistussa kirjeessä sosiaali- ja terveysministeriö suosittelee seulonnan laajentamista viiteen aineenvaihduntasairauteen (CAH, MCAD, LCHAD, GA 1, PKU) vuoden 2015 alussa.

4 NeoPilot-hanke Turussa seulontajärjestelmä rakennettiin vanhempien suostumuksella seulottu n vastasyntynyttä % perheistä osallistui imupaperiverinäyte kantapäästä 2-5 vrk:n iässä kilpirauhasen vajaatoiminta, lisämunuaisen synnynnäinen liikakasvu, n 30 eri amino- ja rasvahappoaineenvaihdunnan sekä ureasyklin sairautta seulottuja sairauksia löytyi

5 Synnynnäinen lisämunuaisen liikakasvu CAH Synnynnäinen lisämunuaishyperplasia eli lisämunuaisten liikakasvu (Congenital Adrenal Hyperplasia - CAH) johtuu viasta lisämunuaisen kuoren steroidihormonien tuotannossa. 90% johtuu steroidi 21-hydroksylaasin puutteesta. Synnynnäisen lisämunuaishyperplasian riski on noin 1: : Häiriö estää tuottamasta monia elintoimintoja ylläpitävää kortisolia ja usein myös suola- ja vesitasapainoa säätelevää aldosteronia, ja lisää mieshormonien eli androgeenien eritystä. Kehittyy vaikea suolavajaus ja kuivuminen, mihin lapsi voi jopa menehtyä muutaman viikon ikäisenä. Tässä sairaudessa sekä tytöt että pojat tuottavat liikaa androgeeneja, minkä takia sairaus voi johtaa epäselvään sukupuoleen vastasyntyneellä vauvalla. Lievemmät muodot, joihin ei liity suolanmenetystä, antavat selviä oireita vasta myöhemmin. Varhainen diagnoosi (17- -hydroksiprogesteroni) ja hormonikorvaushoito estää poikkeavan kehityksen ja tietyissä tapauksissa jopa lapsen kuoleman.

6 Amino- ja rasvahappoaineenvaihdunnan sekä ureasyklin sairaudet Nämä sairaudet aiheuttavat vakavia häiriöitä aineenvaihdunnassa. Osa haittaa energian tuotantoa ja muita elämälle välttämättömiä tapahtumia ja osa johtaa myrkyllisten aineiden kertymiseen. Oireina voi olla oksentelu, huono kasvu, suurentuneet sisäelimet, kehitysvamma, jopa kooma tai kuolema. Arvoidaan, että 5% kätkytkuolemista johtuu synnynnäisistä aineenvaihduntasairauksista. Suureen osaan näistä sairauksista on olemassa hyvin tehoava hoito, joka on useimmiten erityisruokavalio. Ennuste riippuu oleellisesti siitä, paljonko vaurioita on ehtinyt syntyä ennen hoidon aloitusta.

7 Rasvahappojen oksidaatiohäiriöt Esim. MCAD, SCAD, VLCAD, LCHAD Rasvahappojen oksidaatiohäiriöissä elimistö ei kykene normaalilla tavalla käyttämään rasvoja energianlähteenä. Näin ollen lapsi on suuressa riskissä menehtyä ensimmäisten kuukausien aikana hypoglykemiaan. Hoidossa kulmakivenä on paaston välttäminen ja varsinkin ensimmäisten ikävuosien ajan riittävän hiilihydraattipohjaisen energiansaannin turvaaminen tarvittaessa nenämahaletkun tai gastrostooman avulla. Hoito on tehokas. Suomessa esiintyy muita maita yleisemmin erityisesti LCHAD-tautia, joita diagnooseja maassamme on tehty joitakin kymmeniä.

8 VasSeu 2 Ohjeet: -> SASKE->VasSeu 2 Menetelmät Verinäytteestä, joka otetaan kantapääihopistolla näytekorttiin vauvan ollessa 2-5 vuorokauden ikäinen määritetään amino- ja rasvahappojen, ureasyklin metaboliittien sekä 17 -OH-progesteronin pitoisuudet. Analyysimenetelminä käytetään nestekromatografiatandem-massaspektrometriaa (2 kpl) ja immunokemiaa (2 kpl).

9 Näytteenottokortti

10 Näyte otetaan 2-5vrk syntymän jälkeen. Näytteenottokohtana kantapään sivut. Puhdistus 70% alkoholi +ilmakuivaus. Lansetin terä max. 1 mm syvä. Ensimmäinen pisara pyyhitään pois. Puhtaalla kapillaarilla verta imupaperille. Kortin kuivatus väh. 3 h vaakatasossa huoneenlämmössä.

11 VasSeu 2 Tekotiheys Jatkuva analysointi. Vastaus annetaan kahden viikon sisällä näytteen saapumisesta. Tulkinta Tutkimuspyyntö ja seulontatulos laboratorion tietojärjestelmän (Multilab) kautta. Normaali seulontatulos vastataan Normaali. Poikkeavasta seulontatuloksesta annetaan erillinen lausunto, ja lastenlääkäri ottaa yhteyttä perheeseen/sairaalaan. Lääkäri tutkii lapsen ja hänestä otetaan seurantanäyte. Jatkotutkimuksilla varmistetaan seulontatutkimuksen tulos ja tarvittaessa aloitetaan heti asianmukainen hoito.

12 Seulottavat sairaudet I Aminohappojen aineenvaihdunnan sairaudet Fenyyliketonuria (PKU) Homokystinuria Hyperornitinemia-gyrata-atrofia (HOGAtauti) Tyrosinemia tyyppi 1 Vaahterasiirappitauti (MSUD) Endokrinologiset sairaudet Synnynnäinen lisämunuaisen liikakasvu (CAH)

13 Seulottavat sairaudet II Orgaanisten happojen aineenvaihdunnan häiriöt Synnynnäinen B12-vitamiinin puutos Glutaarihappovirtsaisuus tyyppi I (GA I) Isovaleerihappovirtsaisuus Metyylimalonihappovirtsaisuus Propionihappovirtsaisuus Ureasyklin häiriöt Sitrullinemia Arginiinimeripihkahappouria (ASA-uria) Argininemia

14 Seulottavat sairaudet III Rasvahappojen aineenvaihdunnan häiriöt Karnitiinin puutos* CACT (karnitiini-asyylikarnitiinitranslokaasin puutos) CPT (karnitiinipalmityylitransferaasin puutos) tyyppi I CPT (karnitiinipalmityylitransferaasin puutos) tyyppi II CUD (karnitiinin kuljetushäiriö) Glutaarihappovirtsaisuus tyyppi II (GA II) MCAD (keskipitkäketjuisten rasvahappojen asyyli-coadehydrogenaasin puutos) LCHAD (pitkäketjuisten rasvahappojen 3-hydroksi-asyyli- CoA dehydrogenaasin puutos)/tfp (Trifunctional Protein Deficiency) VLCAD (hyvin pitkäketjuisten rasvahappojen asyyli-coadehydrogenaasin puutos)

15 Seulonnalla tavattavat tautitapaukset Suomessa - Suomessa arvioidaan syntyvän vuosittain aineenvaihduntasairautta, joiden sairaus olisi todettu käyttämässämme laajennetussa seulonnassa

16 Seulonta, SASKE ja Kansallinen seulontakeskus alkaen vastasyntyneiden aineen-vaihduntasairauksien seulonta (VasSeu1) on otettu TYKSLABin tutkimusvalikoimaan ja sitä tarjotaan kaikille VSSHP:ssa 6/2013 aloitettu erillinen PKU-seulonta, jota tarjotaan myös ulkopuolisille asiakkaille 6/2014 SASKE Synnynnäisten Aineenvaihduntasairauksien SeulontaKEskus perustetaan TYKSiin HUSin vastasyntyneiden seulonta (VasSeu2) 5/2015 Vaasan ja Porin shp:t

17 Potilastapaus Rasvahappo-oksidaatiohäiriö LCHAD Vastasyntyneen aineenvaihduntasairauksien seulonta Kirsti Näntö-Salonen, Harri Niinikoski, Jussi Mertsola TYKS lasten ja nuorten klinikka Ilkka Mononen, Anna Linko-Parvinen, Riikka Kurkijärvi Tykslab ja SASKE SLY vuosikokous Helsinki

18 LCHAD Kuuluu suomalaiseen tautiperintöön: kantajafrekvenssi 1:240. N. 40 potilasta diagnosoitu Useimmiten imeväisiässä metabolinen kriisi paaston/infektion laukaisemana: hypoketoottinen hypoglykemia + hepatomegalia, maksan toiminnan häiriö,rasvamaksa + kardiomyopatia + lihasheikkous + retinopatia + etenevä perifeerinen neuropatia + joskus hypoparatyreoosi

19 LCHAD-puutos, Tynin tauti Pitkäketjuisten rasvahappojen 3-hydroksiasyyli-CoA-dehydrogenaasin puutos Rasvahappojen ß-oksidaation häiriö: - Kudosten energian puute paastotilanteissa - Toksisten välituotteiden kertyminen Tyni ja Pihko, Duodecim :1331-9

20 Terveiden vanhempien 1/1 lapsi. Ei yhteisiä sukujuuria; ei metab. tautiin viittaavaa SGA-seuranta. Äidillä HELLP-syndrooma. Verinen vuoto h. 33+2; synnytys käynnistyi. 1 kortisoni. Sektio KTG-käyrän takia, apgar 8/8/8 1535g (-2.5 SD) Ongelmaton keskolavaihe, kotiutuu gestaatioiässä 35+6 painolla 1700g. Ei hypoglykemia, ei asidoosia, maksa normaali

21 SEULONTA: Asyylikarnitiiniprofiili B-Vasseu-1 2 vrk:n iässä Vastaus 9 vrk iässä: Useiden pitkäketjuisten hydroksiasyylikarnitiinien pitoisuudet (C16-OH, C18:1-OH, C18-OH) LCHAD? VARMISTUS: Virtsan orgaaniset hapot (HUSLab) Asyylikarnitiiniprofiili (Newcastle, UK) Geenitesti (HUSLab) C6 ja C8 dikarboksyylihappojen ja (C6-C14)-3-hydroksidikarboksyylihappojen pitoisuudet Useiden pitkäketjuisten hydroksiasyylikarnitiinien pitoisuudet HADHA-geenin mutaatio c.1528g>c homotsygoottisena

22 Hoito ja seuranta Alkuun rintamaito, syötöt 3 t välein, verensokeriseuranta Diagnoosin alkaessa varmistua 3 vk iässä LCHAD dieettihoito. - Ei rintamaitoa; erityisravintovalmiste Oireeton, kasvaa hyvin verensokeritasot, ALAT, sydämen uä normaali Kontrollit toistaiseksi viikon välein

23 Kannattiko seulonta? Potilaan kannalta ilman muuta: Äkkikuolema Metabolinen kriisi, hypoglykemia, vauriot Retinopatia, kardiomyopatia, neuropatia Vältettävissä Vältettävissä Riski (?) Kustannukset yhteiskunnalle 16 v ikään mennessä: Todelliset Nykyarvoon diskontatut Oireeton, dieettihoidossa Vaikeasti vammautunut (FinOHTAn rapotti 22, 2004) Erotus: =

24 Yhteenveto Vuosittain Suomessa syntyy arviolta sellaista hoidettavaa aineenvaihduntatautia sairastavaa lasta, joita nykyisellä kilpirauhasen vajaatoiminnan seulonnalla ei todeta, mutta voidaan todeta edellä kuvatulla seulonnalla. Vastasyntyneiden aineenvaihduntasairauksien seulonnan laajentamiseen noin 30 tutkimaamme sairauteen on maassamme tarvittava osaaminen. Perheet hyväksyneet seulonnan erittäin hyvin. Mahdollista luoda valtakunnallinen näyterekisteri/biopankki Näistä lähtökohdista laajennettu vastasyntyneiden harvinaisten aineenvaihduntasairauksien seulonta on aloitettu vastasyntyneille Varsinais-Suomessa Kansallinen seulonta on perusteltua ja laajenemassa nopeasti

VASTASYNTYNEIDEN HARVINAISTEN SYNNYNNÄISTEN AINEENVAIHDUNTA- SAIRAUKSIEN SEULONTA

VASTASYNTYNEIDEN HARVINAISTEN SYNNYNNÄISTEN AINEENVAIHDUNTA- SAIRAUKSIEN SEULONTA VASTASYNTYNEIDEN HARVINAISTEN SYNNYNNÄISTEN AINEENVAIHDUNTA- SAIRAUKSIEN SEULONTA Synnynnäiset aineenvaihduntasairaudet Harvinaisia, periytyviä sairauksia Esiintyvyys < 1:2000 Oireet ilmenevät yleensä

Lisätiedot

Vastasyntyneen aineenvaihduntatautien seulonta

Vastasyntyneen aineenvaihduntatautien seulonta Vastasyntyneen aineenvaihduntatautien seulonta Harri Niinikoski Lastentautien erikoislääkäri Lääketieteellisen ravitsemusopin professori TYKS lastenklinikka ja TY biolääketiede 10/2015 SUONENsisäinen ravitsemus

Lisätiedot

Vastasyntyneen aineenvaihduntasairauksien seulonta. 5.2.2015 Risto Lapatto Lastenklinikka, HYKS ja HY

Vastasyntyneen aineenvaihduntasairauksien seulonta. 5.2.2015 Risto Lapatto Lastenklinikka, HYKS ja HY Vastasyntyneen aineenvaihduntasairauksien seulonta 5.2.2015 Risto Lapatto Lastenklinikka, HYKS ja HY Sidonnaisuudet Työsuhde: HY ja HYKS Lisäksi koulutuspalkkioita: Invalidiliitto, Iiris, Rinnekotisäätiö,

Lisätiedot

Vastasyntyneiden aineenvaihduntaseula. 24.9.2015 Risto.Lapatto@Hus.Fi HY ja HYKS Lastenklinikka

Vastasyntyneiden aineenvaihduntaseula. 24.9.2015 Risto.Lapatto@Hus.Fi HY ja HYKS Lastenklinikka Vastasyntyneiden aineenvaihduntaseula 24.9.2015 Risto.Lapatto@Hus.Fi HY ja HYKS Lastenklinikka Esityksen tavoitteet Ymmärrät mistä tässä on kyse Seulontoja on erilaisia Näyte otetaan vauvasta Ketään ei

Lisätiedot

Vastasyntyneiden aineenvaihduntasairauksien seulonta. 9.10.2014 Risto Lapatto HY ja HYKS Lastenklinikka

Vastasyntyneiden aineenvaihduntasairauksien seulonta. 9.10.2014 Risto Lapatto HY ja HYKS Lastenklinikka Vastasyntyneiden aineenvaihduntasairauksien seulonta 9.10.2014 Risto Lapatto HY ja HYKS Lastenklinikka Sidonnaisuudet Työsuhde: HY ja HYKS Lisäksi koulutuspalkkioita: Invalidiliitto, Iiris, Rinnekotisäätiö,

Lisätiedot

METABOLISTEN SAIRAUKSIEN ANALYTIIKAN JÄRJESTÄMINEN NORDLAB OULUSSA. Marja-Kaisa Koivula Sairaalakemisti, FT, dosentti

METABOLISTEN SAIRAUKSIEN ANALYTIIKAN JÄRJESTÄMINEN NORDLAB OULUSSA. Marja-Kaisa Koivula Sairaalakemisti, FT, dosentti METABOLISTEN SAIRAUKSIEN ANALYTIIKAN JÄRJESTÄMINEN NORDLAB OULUSSA Marja-Kaisa Koivula Sairaalakemisti, FT, dosentti Esityksen sisältö Johdanto Kromatografiset menetelmät Entsymaattinen määritysmenetelmä

Lisätiedot

D ADEK-vitamiini Vitamiini- tai hivenainevalmiste Ei Ei korvattava. Kliininen ravintovalmiste

D ADEK-vitamiini Vitamiini- tai hivenainevalmiste Ei Ei korvattava. Kliininen ravintovalmiste Liitetaulukko 3. Vastauksissa esiintyneet sairaudet ja sairausryhmät 1, joiden hoidossa käytettiin ravintoita. Veren ja verta muodostavien elinten sairaudet sekä eräät immuunimekanismin häiriöt Eräät vaikeat

Lisätiedot

Vastasyntyneiden harvinaisten aineenvaihduntatautien seulonta

Vastasyntyneiden harvinaisten aineenvaihduntatautien seulonta Ilona Autti-Rämö, Liisa Laajalahti, Hanna Koskinen, Harri Sintonen, Marjukka Mäkelä ja asiantuntijaryhmä Tandem-massaspektrometria on melko uusi teknologia, jolla voidaan seuloa kymmeniä harvinaisia aineenvaihduntatauteja

Lisätiedot

Seulontatutkimusten perusperiaatteet

Seulontatutkimusten perusperiaatteet Seulontatutkimusten perusperiaatteet Ilona Autti-Rämö, dos Finohta / Sikiöseulontojen yhtenäistäminen / Ilona Autti-Rämö 1 Seulontatutkimuksen yleiset periaatteet Tutkitaan sovittu ryhmä oireettomia henkilöitä,

Lisätiedot

ikiön seulonta- ja kromosomitutkimukset

ikiön seulonta- ja kromosomitutkimukset POTILASOHJE 1 (8) S ikiön seulonta- ja kromosomitutkimukset POTILASOHJE 2 (8) SISÄLLYSLUETTELO Mitä kehityshäiriöiden seulonta tarkoittaa? 3 Ultraääniseulontatutkimukset 4 Varhainen ultraääniseulonta Toisen

Lisätiedot

Jyviä ja akanoita Milloin seulonta lisää terveyttä? Prof. Marjukka Mäkelä FinOHTA/Stakes

Jyviä ja akanoita Milloin seulonta lisää terveyttä? Prof. Marjukka Mäkelä FinOHTA/Stakes Jyviä ja akanoita Milloin seulonta lisää terveyttä? Prof. Marjukka Mäkelä FinOHTA/Stakes Jyviä ja akanoita Leikkuupuimuri seuloo jyvät mukaan ja akanat pois. Terveydenhuollon seulonnoissa halutaan löytää

Lisätiedot

PERHEPESÄ Jorvin sairaala

PERHEPESÄ Jorvin sairaala PERHEPESÄ Jorvin sairaala Tervetuloa Perhepesään ONNEA UUDESTA VAUVASTA JA TERVETULOA PERHEPESÄÄN! Perhepesässä koko perhe saa olla yhdessä ja tutustua rauhassa toisiinsa ympäri vuorokauden. Perhepesässä

Lisätiedot

Eduskunnan puhemiehelle

Eduskunnan puhemiehelle KIRJALLINEN KYSYMYS 1173/2006 vp Vastasyntyneiden neonataaliseulonta Eduskunnan puhemiehelle Vastasyntyneiden seulonta on ehkäisevä terveydellinen toimenpide, jossa etsitään näennäisesti terveistä lapsista

Lisätiedot

HARVINAISSAIRAUKSIEN YKSIKKÖ VSSHP

HARVINAISSAIRAUKSIEN YKSIKKÖ VSSHP HARVINAISSAIRAUKSIEN YKSIKKÖ VSSHP Jussi Mertsola Prof, toimialuejohtaja Lasten ja nuorten klinikka, TYKS 7.10.2015 Harvinaiset sairaudet sairauaa on korkeintaan 1 / 2000 ihmistä kohden harvinaissairauksia

Lisätiedot

Paksusuolisyövän seulontatulokset Suomessa. Nea Malila Suomen Syöpärekisteri

Paksusuolisyövän seulontatulokset Suomessa. Nea Malila Suomen Syöpärekisteri Paksusuolisyövän seulontatulokset Suomessa Suomen Syöpärekisteri Sidonnaisuudet kahden viimeisen vuoden ajalta LT, dosentti Päätoimi Suomen Syöpärekisterin johtaja, Suomen Syöpäyhdistys ry Sivutoimet syöpäepidemiologian

Lisätiedot

Helsingin kaupunki Pöytäkirja 10/2012 1 (7) Terveyslautakunta Tja/6 29.05.2012

Helsingin kaupunki Pöytäkirja 10/2012 1 (7) Terveyslautakunta Tja/6 29.05.2012 Helsingin kaupunki Pöytäkirja 10/2012 1 (7) 151 Terveyslautakunnan lausunto suolistosyövän seulontaa koskevasta talousarvioaloitteesta HEL 2012-003464 T 00 00 03 Päätös päätti antaa aloitteesta seuraavan,

Lisätiedot

Avainsanat: BI5 III Biotekniikan sovelluksia 9. Perimä ja terveys.

Avainsanat: BI5 III Biotekniikan sovelluksia 9. Perimä ja terveys. Avainsanat: mutaatio Monitekijäinen sairaus Kromosomisairaus Sukupuu Suomalainen tautiperintö Geeniterapia Suora geeninsiirto Epäsuora geeninsiirto Kantasolut Totipotentti Pluripotentti Multipotentti Kudospankki

Lisätiedot

Syöpäseulonnat I - sairauksien ennaltaehkäisyä

Syöpäseulonnat I - sairauksien ennaltaehkäisyä Syöpäseulonnat I - sairauksien ennaltaehkäisyä Janne Pitkäniemi 1,2 1 Suomen Syöpärekisteri ja 2 Helsingin yliopisto Suomen Syöpärekisteri,Finnish Cancer Registry Institute for Statistical and Epidemiological

Lisätiedot

Miten genomitieto on muuttanut ja tulee muuttamaan erikoissairaanhoidon käytäntöjä

Miten genomitieto on muuttanut ja tulee muuttamaan erikoissairaanhoidon käytäntöjä Miten genomitieto on muuttanut ja tulee muuttamaan erikoissairaanhoidon käytäntöjä Genomitiedon vaikutus terveydenhuoltoon työpaja 7.11.2014 Sitra, Helsinki Jaakko Ignatius, TYKS Kliininen genetiikka Perimän

Lisätiedot

Keuhkoahtaumataudin varhaisdiagnostiikka ja spirometria. Esko Kurttila Keuhkosairauksien ja työterveyshuollon erikoislääkäri

Keuhkoahtaumataudin varhaisdiagnostiikka ja spirometria. Esko Kurttila Keuhkosairauksien ja työterveyshuollon erikoislääkäri Keuhkoahtaumataudin varhaisdiagnostiikka ja spirometria Esko Kurttila Keuhkosairauksien ja työterveyshuollon erikoislääkäri Epidemiologia N. 10%:lla suomalaisista on keuhkoahtaumatauti Keuhkoahtaumatauti

Lisätiedot

LIITE III MUUTOKSET VALMISTEYHTEENVETOON JA PAKKAUSSELOSTEESEEN

LIITE III MUUTOKSET VALMISTEYHTEENVETOON JA PAKKAUSSELOSTEESEEN LIITE III MUUTOKSET VALMISTEYHTEENVETOON JA PAKKAUSSELOSTEESEEN 41 KABERGOLIINIA SISÄLTÄVIEN LÄÄKEVALMISTEIDEN VALMISTEYHTEENVEDON 4.2 Annostus ja antotapa: Seuraava tieto tulee lisätä sopivalla tavalla:

Lisätiedot

Vastasyntyneen veriryhmämääritys ja sopivuuskoeongelmat

Vastasyntyneen veriryhmämääritys ja sopivuuskoeongelmat Vastasyntyneen veriryhmämääritys ja sopivuuskoeongelmat Laboratoriolääketiede ja näyttely 2014 Susanna Sainio,SPR Veripalvelu 1 1 1 2 2 2 Vastasyntyneen veriryhmämääritys ABO A ja B antigeenien määrä punasolujen

Lisätiedot

PLENADREN RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO VERSIO 3.0

PLENADREN RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO VERSIO 3.0 PLENADREN RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO VERSIO 3.0 VI.2 VI.2.1 JULKISEN YHTEENVEDON OSIOT Tietoa sairauden esiintyvyydestä PLENADREN-valmistetta käytetään lisämunuaisten vajaatoiminnan

Lisätiedot

5 RASKAUDENILMOITUSLOMAKE

5 RASKAUDENILMOITUSLOMAKE 5 RASKAUDENILMOITUSLOMAKE RO-GNE: RASKAUDEN ILMOITUSLOMAKE ILMOITTAJAN TIEDOT Ensimmäinen Seuranta Ilmoittajan nimi: Tyyppi: Lääkäri (erikoisala) Farmaseutti/proviisori Kuluttaja Muu (mikä) Yhteydenotto-osoite:

Lisätiedot

Tyypin 2 diabetes sairautena

Tyypin 2 diabetes sairautena Tyypin 2 diabetes sairautena Liisa Hiltunen / PPSHP Diabetes Sokeriaineenvaihduntahäiriö, jossa häiriö insuliinihormonin erityksessä ja/tai toiminnassa, mistä johtuen verensokeri kohoaa usein häiriöitä

Lisätiedot

Sikiöseulonnat. Opas raskaana oleville. www.eksote.fi

Sikiöseulonnat. Opas raskaana oleville. www.eksote.fi Sikiöseulonnat Opas raskaana oleville www.eksote.fi Raskauden seuranta ja sikiötutkimukset ovat osa suomalaista äitiyshuoltoa. Niiden tarkoitus on todeta, onko raskaus edennyt normaalisti, sekä saada tietoja

Lisätiedot

Koiran sydämen vajaatoiminta

Koiran sydämen vajaatoiminta Koiran sydämen vajaatoiminta Sydämen vajaatoimintaa voidaan hoitaa ja pidentää odotettavissa olevaa elinaikaa. Koirankin sydän voi sairastua Koiran sydänsairauksista Sydämen vajaatoiminta on yleinen vaiva

Lisätiedot

X-kromosominen periytyminen. Potilasopas. TYKS Perinnöllisyyspoliklinikka PL 52, 20521 Turku puh (02) 3131 390 faksi (02) 3131 395

X-kromosominen periytyminen. Potilasopas. TYKS Perinnöllisyyspoliklinikka PL 52, 20521 Turku puh (02) 3131 390 faksi (02) 3131 395 12 X-kromosominen periytyminen TYKS Perinnöllisyyspoliklinikka PL 52, 20521 Turku puh (02) 3131 390 faksi (02) 3131 395 FOLKHÄLSANS GENETISKA KLINIK PB 211, (Topeliusgatan 20) 00251 Helsingfors tel (09)

Lisätiedot

Yleistä metabolisten sairauksien analytiikasta

Yleistä metabolisten sairauksien analytiikasta Yleistä metabolisten sairauksien analytiikasta Leila Risteli, LKT, FM, dosentti, ylilääkäri Suomen Kliinisen Kemian Yhdistyksen kokous Oulussa 23.4.2015 Mitä nämä sairaudet ovat? - geneettisesti määräytyviä

Lisätiedot

Peittyvä periytyminen. Potilasopas. Kuvat: Rebecca J Kent www.rebeccajkent.com rebecca@rebeccajkent.com

Peittyvä periytyminen. Potilasopas. Kuvat: Rebecca J Kent www.rebeccajkent.com rebecca@rebeccajkent.com 12 Peittyvä periytyminen Muokattu allamainittujen instanssien julkaisemista vihkosista, heidän laatustandardiensa mukaan: Guy's and St Thomas' Hospital, London, United Kingdom; and the London IDEAS Genetic

Lisätiedot

Suomalainen maksa - ja miten se on marinoitu

Suomalainen maksa - ja miten se on marinoitu Suomalainen maksa - ja miten se on marinoitu Helena Isoniemi ylilääkäri, professori Elinsiirto- ja maksakirurgian klinikka Martti Färkkilä ylilääkäri, professori Gastroenterologia HYKS 13.3.2014 Alkoholi

Lisätiedot

Helsingin kaupunki Esityslista 9/2013 1 (5) Sosiaali- ja terveyslautakunta Sotep/33 4.6.2013

Helsingin kaupunki Esityslista 9/2013 1 (5) Sosiaali- ja terveyslautakunta Sotep/33 4.6.2013 Helsingin kaupunki Esityslista 9/2013 1 (5) 33 Kohdunkaulan syövän seulontatutkimusten hankinta HUSLABliikelaitokselta Pöydälle 14.05.2013 HEL 2013-006323 T 02 08 02 01 Päätösehdotus Esittelijä Taustaa

Lisätiedot

Sikiöseulonnat OPAS LASTA ODOTTAVILLE. Tietoa sikiön kromosomi- ja rakennepoikkeavuuksien seulonnoista

Sikiöseulonnat OPAS LASTA ODOTTAVILLE. Tietoa sikiön kromosomi- ja rakennepoikkeavuuksien seulonnoista Tämä esite on tarkoitettu kaikille lasta odottaville vanhemmille. Vanhempien toivotaan tutustuvan esitteeseen yhdessä. Sikiö seulontoihin osallistuminen on vapaaehtoista. Sikiöseulonnat OAS LASTA ODOTTAVILLE

Lisätiedot

Annika Rökman. sovellusasiantuntija, FT, sairaalegeneetikko, datanomi

Annika Rökman. sovellusasiantuntija, FT, sairaalegeneetikko, datanomi Annika Rökman sovellusasiantuntija, FT, sairaalegeneetikko, datanomi Oma taustani FM genetiikka 1998 sairaalageneetikko 2004 FT Perinnöllisestä eturauhassyövästä 2004 Finaksen teknisenä arvioijana vuodesta

Lisätiedot

Sikiöseulonnat OPAS RASKAANA OLEVILLE. Tietoa sikiön kromosomi- ja rakennepoikkeavuuksien seulonnoista

Sikiöseulonnat OPAS RASKAANA OLEVILLE. Tietoa sikiön kromosomi- ja rakennepoikkeavuuksien seulonnoista Tämä esite on tarkoitettu kaikille raskaana oleville. Vanhempien toivotaan tutustuvan esitteeseen yhdessä. Sikiö seulontoihin osallistuminen on vapaaehtoista. Sikiöseulonnat OPAS RASKAANA OLEVILLE Tietoa

Lisätiedot

Vuoden 2015 kurssit. Omaishoitajat

Vuoden 2015 kurssit. Omaishoitajat Vuoden 2015 kurssit Omaishoitajat Avh-kommunikaatio Parkinsonin tauti Primaarinen ataksia Epilepsia Downin oireyhtymä CP-oireyhtymä Kehitysvammat ja -häiriöt sekä monivammat Myastenia gravis (MG) ALS Lihassairaus

Lisätiedot

Diabetes (sokeritauti)

Diabetes (sokeritauti) Diabetes (sokeritauti) Lääkärikirja Duodecim Pertti Mustajoki, sisätautien erikoislääkäri Diabeteksessa eli sokeritaudissa veren sokerimäärä on liian korkea. Lääkäri tai hoitaja mittaa verensokerin verinäytteestä

Lisätiedot

NAINEN PIDÄ HUOLTA ITSESTÄSI TERVEYS ALKAA TIEDOSTA

NAINEN PIDÄ HUOLTA ITSESTÄSI TERVEYS ALKAA TIEDOSTA NAINEN PIDÄ HUOLTA ITSESTÄSI TERVEYS ALKAA TIEDOSTA 1 RINTAOIREET JA RINTOJEN SEURANTA Nainen huolehdi rintojesi terveydestä. Rintakuvauksiin tullaan yleensä joko oireettomille tehdyn seulontatutkimuksen

Lisätiedot

RhD-negatiivisten äitien suojaus raskauden aikana

RhD-negatiivisten äitien suojaus raskauden aikana RhD-negatiivisten äitien suojaus raskauden aikana Valtakunnalliset Neuvolapäivät 9.10.2013 Susanna Sainio SPR Veripalvelu 1 1 1 1 1 Raskausimmunisaation syntymekanismi fetomaternaalivuoto FMH: 1. trim.

Lisätiedot

Rintasyöpä ja sen ehkäisy. Jaana Kolin

Rintasyöpä ja sen ehkäisy. Jaana Kolin Rintasyöpä ja sen ehkäisy Jaana Kolin Syöpä sairautena Uusia syöpiä todetaan maassamme vuosittain noin 29.000 Miehillä ja naisilla syöpiä todetaan suurin piirtein yhtä paljon Vuoteen 2020 mennessä uusien

Lisätiedot

Espoon kaupunki Pöytäkirja 134. Kaupunginhallitus 07.05.2012 Sivu 1 / 1

Espoon kaupunki Pöytäkirja 134. Kaupunginhallitus 07.05.2012 Sivu 1 / 1 Kaupunginhallitus 07.05.2012 Sivu 1 / 1 1147/06.01.01/2012 134 Valtuustokysymys suolistosyövän seulonnoista (Kv-asia) Valmistelijat / lisätiedot: Pohjanpalo Aila, puh. (09) 816 23040 etunimi.sukunimi@espoo.fi

Lisätiedot

Sikiön kehityshäiriöiden. Mahdollinen alaotsikko (Calibri 28) www.eksote.fi

Sikiön kehityshäiriöiden. Mahdollinen alaotsikko (Calibri 28) www.eksote.fi Sikiön kehityshäiriöiden seulonta Mahdollinen alaotsikko (Calibri 28) www.eksote.fi Raskauksien seuranta ja sikiötutkimukset ovat osa suomalaista äitiyshuoltoa. Äidit voivat osallistua vapaaehtoiseen sikiön

Lisätiedot

Lasten virtsatieinfektioiden diagnostiikan ja hoidon kulmakivet

Lasten virtsatieinfektioiden diagnostiikan ja hoidon kulmakivet 25.10.2007 Lasten virtsatieinfektioiden diagnostiikan ja hoidon kulmakivet Ville Peltola TYKS, lastenklinikka Insidenssi Suurin < 1-v: pojat = tytöt, n. 7/1000 1-v: tytöt > pojat 8% tytöistä sairastaa

Lisätiedot

Seulontavaihtoehdot ja riskit

Seulontavaihtoehdot ja riskit Seulontavaihtoehdot ja riskit Hannele Laivuori HUSLAB Perinnöllisyyslääketieteen yksikkö Jaakko Ignatius TYKS, Perinnöllisyyslääketiede Finohta / Sikiöseulontojen yhtenäistäminen / Hannele Laivuori ja

Lisätiedot

Autoimmuunitaudit: osa 1

Autoimmuunitaudit: osa 1 Autoimmuunitaudit: osa 1 Autoimmuunitaute tunnetaan yli 80. Ne ovat kroonisia sairauksia, joiden syntymekanismia eli patogeneesiä ei useimmissa tapauksissa ymmärretä. Tautien esiintyvyys vaihtelee maanosien,

Lisätiedot

Vallitseva periytyminen. Potilasopas. Kuvat: Rebecca J Kent www.rebeccajkent.com rebecca@rebeccajkent.com

Vallitseva periytyminen. Potilasopas. Kuvat: Rebecca J Kent www.rebeccajkent.com rebecca@rebeccajkent.com 12 Vallitseva periytyminen Muokattu allamainittujen instanssien julkaisemista vihkosista, heidän laatustandardiensa mukaan: Guy's and St Thomas' Hospital, London, United Kingdom; and the London IDEAS Genetic

Lisätiedot

Valtuuskunnille toimitetaan oheisena asiakirja D043528/02 Liite.

Valtuuskunnille toimitetaan oheisena asiakirja D043528/02 Liite. Euroopan unionin neuvosto Bryssel, 8. maaliskuuta 2016 (OR. en) 6937/16 ADD 1 TRANS 72 SAATE Lähettäjä: Euroopan komissio Saapunut: 7. maaliskuuta 2016 Vastaanottaja: Kom:n asiak. nro: Asia: Neuvoston

Lisätiedot

4.2.2009 Keskiviikko Avajaiset. 1. Hematologia

4.2.2009 Keskiviikko Avajaiset. 1. Hematologia Avajaiset 09:00 Päivien avaus; Ilkka Mononen, Europaeaa Labquality Oy:n hallituksen puheenjohtaja 2009 Laadunedistämispalkinnot 09:20 Avausluento Sosiaali- ja terveyspolitiikan ajankohtaiset näkymät; ylijohtaja

Lisätiedot

Kokemuksia vieritutkimuksista TYKS:n Lastenpoliklinikalla. Jussi Mertsola Professori Lastenpkl:n osastonylilääkäri TYKS

Kokemuksia vieritutkimuksista TYKS:n Lastenpoliklinikalla. Jussi Mertsola Professori Lastenpkl:n osastonylilääkäri TYKS Kokemuksia vieritutkimuksista TYKS:n Lastenpoliklinikalla Jussi Mertsola Professori Lastenpkl:n osastonylilääkäri TYKS Lastenklinikka Kriittinen asenne laboratorio- ja rtgtutkimuksiin Ensin kliininen tutkiminen,

Lisätiedot

Oili Aumo, kätilö 25.9.2015 Vantaa

Oili Aumo, kätilö 25.9.2015 Vantaa Oili Aumo, kätilö 25.9.2015 Vantaa SIKIÖSEULONNAT SUOMESSA Seulonta-asetus annettiin v 2007 (1339/2006 päivitys 339/2011), jolloin annettiin kolmen vuoden siirtymäaika. Seulonta Seulonta on osa ehkäisevää

Lisätiedot

KEESHOND TERVEYSKYSELY

KEESHOND TERVEYSKYSELY KEESHOND TERVEYSKYSELY Vuosi 2008 Hyvä kessun omistaja, Ole hyvä ja täytä etusivulle kysytyt koiran, kasvattajan ja omistajan tiedot. Rastita toiselle sivulle tiedot koiran virallisista tutkimustuloksista.

Lisätiedot

Ari Rosenvall Yleislääketieteen erikoislääkäri 10.11.2015

Ari Rosenvall Yleislääketieteen erikoislääkäri 10.11.2015 Ari Rosenvall Yleislääketieteen erikoislääkäri 10.11.2015 Muistisairauksista Muistisairauksien lääkehoidon periaatteet Muistisairauden hoidon kokonaisuus Lääkkeettömät hoidot Etenevät muistisairaudet ovat

Lisätiedot

TERVEYS ALKAA TIEDOSTA NAINEN PIDÄ HUOLTA ITSESTÄSI

TERVEYS ALKAA TIEDOSTA NAINEN PIDÄ HUOLTA ITSESTÄSI TERVEYS ALKAA TIEDOSTA NAINEN PIDÄ HUOLTA ITSESTÄSI 1 RINTAOIREET JA RINTOJEN SEURANTA Jokaisen naisen on syytä pitää huolta rintojensa terveydestä. Rintakuvauksiin tullaan yleensä joko oireettomille tehdyn

Lisätiedot

301111 Mitä tavallinen psykiatri ymmärtää kehitysvammaisen mielenterveysongelmista? Yl juha kemppinen

301111 Mitä tavallinen psykiatri ymmärtää kehitysvammaisen mielenterveysongelmista? Yl juha kemppinen 301111 Mitä tavallinen psykiatri ymmärtää kehitysvammaisen mielenterveysongelmista? Yl juha kemppinen Vastaus: hyvin vähän Tietoakin on ollut vaikea hankkia, nyt on juuri uusi kirja julkaistu Tavallisimmin

Lisätiedot

Tuberkuloosi ja raskaus. Esa Rintala, ylilääkäri Sairaalahygienia- ja infektiontorjuntayksikkö VSSHP 16.4.2015

Tuberkuloosi ja raskaus. Esa Rintala, ylilääkäri Sairaalahygienia- ja infektiontorjuntayksikkö VSSHP 16.4.2015 Tuberkuloosi ja raskaus Esa Rintala, ylilääkäri Sairaalahygienia- ja infektiontorjuntayksikkö VSSHP 16.4.2015 Tuberkuloosi Suomessa 500 450 400 350 Tapauksia 300 250 200 Keuhkotbc Muu tbc 150 100 50

Lisätiedot

Ylidiagnostiikkaa: onko kohta enää terveitä? LL Iris Pasternack HYKS Psykiatrian klinikka, tiistailuento 25.2.2014

Ylidiagnostiikkaa: onko kohta enää terveitä? LL Iris Pasternack HYKS Psykiatrian klinikka, tiistailuento 25.2.2014 Ylidiagnostiikkaa: onko kohta enää terveitä? LL Iris Pasternack HYKS Psykiatrian klinikka, tiistailuento 25.2.2014 The New York Times Feb 11 2014 Miller A et al. 25 year follow up for breast cancer incidence

Lisätiedot

Lapsen näön seulonta neuvolassa Mihin suositukset perustuvat? Päivi Lindahl Silmätautien erikoislääkäri HYKS silmätautien klinikka Lasten yksikkö

Lapsen näön seulonta neuvolassa Mihin suositukset perustuvat? Päivi Lindahl Silmätautien erikoislääkäri HYKS silmätautien klinikka Lasten yksikkö Lapsen näön seulonta neuvolassa Mihin suositukset perustuvat? Päivi Lindahl Silmätautien erikoislääkäri HYKS silmätautien klinikka Lasten yksikkö Suositusten lähtökohdat Määräaikaistarkastusten minimointi

Lisätiedot

Miten asiakkaan äkillinen sekavuus näkyy RAI-järjestelmässä?

Miten asiakkaan äkillinen sekavuus näkyy RAI-järjestelmässä? Tiedosta hyvinvointia 1 Miten asiakkaan äkillinen sekavuus näkyy RAI-järjestelmässä? Erikoissuunnittelija Satu Vihersaari-Virtanen 13.3.2008 Tiedosta hyvinvointia 2 Vanhuksen sekavuusoireyhtymä Sekavuuden

Lisätiedot

LASTEN VIITEARVOISTA. Esa Hämäläinen, oyl, dos HUSLAB Lasten ja Nuorten sairaala

LASTEN VIITEARVOISTA. Esa Hämäläinen, oyl, dos HUSLAB Lasten ja Nuorten sairaala LASTEN VIITEARVOISTA Esa Hämäläinen, oyl, dos HUSLAB Lasten ja Nuorten sairaala Meites et al. 1989 Soldin et al. 1999 Lapset eivät ole pieniä aikuisia Lapsuuden aikana maksan, munuaisten ja keuhkojen toiminta

Lisätiedot

KEUHKOSYÖVÄN SEULONTA. Tiina Palva Dosentti, Syöpätautien ja sädehoidon erikoislääkäri, Väestövastuulääkäri, Kuhmoisten terveysasema

KEUHKOSYÖVÄN SEULONTA. Tiina Palva Dosentti, Syöpätautien ja sädehoidon erikoislääkäri, Väestövastuulääkäri, Kuhmoisten terveysasema KEUHKOSYÖVÄN SEULONTA Tiina Palva Dosentti, Syöpätautien ja sädehoidon erikoislääkäri, Väestövastuulääkäri, Kuhmoisten terveysasema Seulonta on tiettyyn väestöryhmään kohdistuva tutkimus, jolla pyritään

Lisätiedot

Helsingin kaupunki Esityslista 8/2015 1 (5) Sosiaali- ja terveyslautakunta Sotep/16 28.04.2015

Helsingin kaupunki Esityslista 8/2015 1 (5) Sosiaali- ja terveyslautakunta Sotep/16 28.04.2015 Helsingin kaupunki Esityslista 8/2015 1 (5) 16 Sosiaali- ja terveyslautakunnan lausunto kaupunginhallitukselle valtuutettu Pia Pakarisen ym. valtuustoaloitteesta mm. mahasyövän riskin seulonnan pilotin

Lisätiedot

Kaaoksen hallinta (perus)terveydenhuollossa. 17.4.2013 Klas Winell

Kaaoksen hallinta (perus)terveydenhuollossa. 17.4.2013 Klas Winell Kaaoksen hallinta (perus)terveydenhuollossa 17.4.2013 Klas Winell Rakennuspalikat Omien resurssien analyysi Kohdeväestön analyysi Nykyisen toiminnan määrä, laatu, vaikuttavuus ja terveyshyöty analyysi

Lisätiedot

HARVINAISENA SUOMESSA

HARVINAISENA SUOMESSA HARVINAISENA SUOMESSA kokemuksia harvinaisesta sairaudesta ja yhdistyksestä Harvinaisten sairauksien yhdistysten tapaaminen Väestöliitossa Katri Karlsson 10.6.2011 1. HAE eli hereditaarinen angioödeema

Lisätiedot

Tyypin 2 diabetes Hoito-ohje ikääntyneille Ruokavalio ja liikunta. Sairaanhoitajaopiskelijat Lauri Tams ja Olli Vaarula

Tyypin 2 diabetes Hoito-ohje ikääntyneille Ruokavalio ja liikunta. Sairaanhoitajaopiskelijat Lauri Tams ja Olli Vaarula Tyypin 2 diabetes Hoito-ohje ikääntyneille Ruokavalio ja liikunta Sairaanhoitajaopiskelijat Lauri Tams ja Olli Vaarula 1 Johdanto Arviolta 500 000 suomalaista sairastaa diabetesta ja määrä kasvaa koko

Lisätiedot

Voiko muistisairauksia ennaltaehkäistä?

Voiko muistisairauksia ennaltaehkäistä? Voiko muistisairauksia ennaltaehkäistä? Juha Rinne, Neurologian erikoislääkäri ja dosentti Professori PET- keskus ja neurotoimialue, TYKS ja Turun yliopisto MITÄ MUISTI ON? Osatoiminnoista koostuva kyky

Lisätiedot

Vastasyntyneen ECMO-hoidon (ECMO = veren kehonulkoinen happeuttaminen; engl. extracorporeal membrane oxygention) vaikuttavuus

Vastasyntyneen ECMO-hoidon (ECMO = veren kehonulkoinen happeuttaminen; engl. extracorporeal membrane oxygention) vaikuttavuus Finohtan nopea vastaus 1(2) Jaana Leipälä 2011 Vastasyntyneen ECMO-hoidon (ECMO = veren kehonulkoinen happeuttaminen; engl. extracorporeal membrane oxygention) vaikuttavuus Tausta Kysely Vaasan keskussairaalasta

Lisätiedot

Mahamysteeri. Mitkä ruoka-aineet sisältävät näitä aineita?

Mahamysteeri. Mitkä ruoka-aineet sisältävät näitä aineita? KOHDERYHMÄ: Työ voidaan tehdä yläkoulussa tai lukiossa. Teorian laajuus riippuu ryhmän tasosta/iästä. Parhaiten työ soveltuu yläkouluun kokonaisuuteen elollinen luonto ja yhteiskunta. KESTO: 1 h. MOTIVAATIO:

Lisätiedot

Virtsan kemiallisen seulonnan kliininen käyttö. Dosentti Martti L.T. Lalla Osastonylilääkäri HUSLAB Kirurginen sairaala 4.2.2009

Virtsan kemiallisen seulonnan kliininen käyttö. Dosentti Martti L.T. Lalla Osastonylilääkäri HUSLAB Kirurginen sairaala 4.2.2009 Virtsan kemiallisen seulonnan kliininen käyttö Dosentti Martti L.T. Lalla Osastonylilääkäri HUSLAB Kirurginen sairaala Virtsa elimistön tietolähteenä Virtsa - ensimmäinen kehon aine, jonka tutkiminen yhdistettiin

Lisätiedot

Postanalytiikka ja tulosten tulkinta

Postanalytiikka ja tulosten tulkinta Postanalytiikka ja tulosten Veli Kairisto dosentti, kliinisen kemian ja hematologisten laboratoriotutkimusten erikoislääkäri kliininen diagnoosi tulkittu löydös päätös kliininen taso suhteutus viitearvoihin

Lisätiedot

Sairastettu virtsatieinfektio

Sairastettu virtsatieinfektio Sairastettu virtsatieinfektio Mikä on ennuste? Milloin ja miksi annan lähetteen jatkotutkimuksiin? Suomen koulu- ja nuorisolääketieteen yhdistyksen koulutustilaisuus Turku 25.10.2007 Timo Jahnukainen TYKS,

Lisätiedot

B12-vitamiini eli kobalamiini on ihmiselle välttämätön vitamiini. Sitä tarvitaan elintoimintojen entsyymijärjestelmien toiminnallisina osina:

B12-vitamiini eli kobalamiini on ihmiselle välttämätön vitamiini. Sitä tarvitaan elintoimintojen entsyymijärjestelmien toiminnallisina osina: B12-vitamiini B12-vitamiini eli kobalamiini on ihmiselle välttämätön vitamiini. Sitä tarvitaan elintoimintojen entsyymijärjestelmien toiminnallisina osina: solujen jakautumiseen kudosten muodostumiseen

Lisätiedot

NIPT NON-INVASIVE-PRENATAL TESTING

NIPT NON-INVASIVE-PRENATAL TESTING NIPT NON-INVASIVE-PRENATAL TESTING NIPT perustuu äidin veressä olevan sikiöperäisen soluvapaan DNA:n tutkimiseen ja seulonta kattaa sikiön 21-trisomian (Downin syndrooma), 18-trisomian, 13-trisomian

Lisätiedot

Cosentyx-valmisteen (sekukinumabi) riskienhallintasuunnitelman yhteenveto

Cosentyx-valmisteen (sekukinumabi) riskienhallintasuunnitelman yhteenveto EMA/775515/2014 Cosentyx-valmisteen (sekukinumabi) riskienhallintasuunnitelman yhteenveto Tämä on Cosentyx-valmisteen riskienhallintasuunnitelman yhteenveto, jossa esitetään toimenpiteet, joilla varmistetaan,

Lisätiedot

Keuhkoahtaumatauti 2007

Keuhkoahtaumatauti 2007 Keuhkoahtaumatauti 2007 Maailmanlaajuisesti jopa 16 miljoonaa ihmistä sairastaa keuhkoahtaumatautia. Kansainvälisten tutkimusten mukaan 56 85 prosenttia tautitapauksista saattaa olla diagnosoimatta (Kinnula,

Lisätiedot

Veriryhmäimmunisaatiot ja raskaus

Veriryhmäimmunisaatiot ja raskaus Veriryhmäimmunisaatiot ja raskaus Kaarin Mäkikallio Lennart Nilsson Veriryhmät Veriryhmät Phenotype A B AB O Phenotype Rh+ Rh- Genotype AA or AO BB or BO AB OO Genotype Rh+Rh+, Rh+Rh- Rh-Rh- Karl Landsteiner

Lisätiedot

Tarttuvien tautien vastustus

Tarttuvien tautien vastustus Tarttuvien tautien vastustus Eläinlääkäri Katja Hautala Tartuntatautien oireita Hengitystieoireet Kuume Silmävuoto Alentunut suorituskyky Ripuli Ihotulehdukset (sieni, syylät, rivi jne) Keskushermosto-oireet

Lisätiedot

Hengellinen ulottuvuus ja ETENE saattohoidon suositukset

Hengellinen ulottuvuus ja ETENE saattohoidon suositukset Hengellinen ulottuvuus ja ETENE saattohoidon suositukset Ritva Halila dosentti, pääsihteeri etene@stm.fi Sosiaali- ja terveysalan eettinen neuvottelukunta ETENE Sitoumukset: ei kaupallisia sidonnaisuuksia

Lisätiedot

Espoon kaupunki Pöytäkirja 83. Valtuusto 11.06.2012 Sivu 1 / 1

Espoon kaupunki Pöytäkirja 83. Valtuusto 11.06.2012 Sivu 1 / 1 Valtuusto 11.06.2012 Sivu 1 / 1 1147/06.01.01/2012 Kaupunginhallitus 134 7.5.2012 Valtuusto 68 21.5.2012 83 Valtuustokysymys suolistosyövän seulonnoista (Pöydälle 21.5.2012) Valmistelijat / lisätiedot:

Lisätiedot

INFLECTRA SEULONTAKORTTI

INFLECTRA SEULONTAKORTTI Demyelinoiva sairaus Jos potilaalla on aiempi tai äskettäin puhjennut demyelinioiva sairaus, anti-tnf-hoidon hyödyt ja haitat on arvioitava huolellisesti ennen INFLECTRA -hoidon aloitusta. INFLECTRA -hoidon

Lisätiedot

ZA5222. Flash Eurobarometer 287 (Influenza H1N1) Country Specific Questionnaire Finland

ZA5222. Flash Eurobarometer 287 (Influenza H1N1) Country Specific Questionnaire Finland ZA5222 Flash Eurobarometer 287 (Influenza H1N1) Country Specific Questionnaire Finland FLASH 287 INFLUENZA Q1. Aiotteko ottaa kausi influenssarokotuksen tänä vuonna? Kyllä, olen jo ottanut rokotuksen...

Lisätiedot

Silmänpainetauti Dg, hoito ja seuranta

Silmänpainetauti Dg, hoito ja seuranta Silmänpainetauti Dg, hoito ja seuranta Suomen Silmähoitajapäivät 26.8.2011 Paasitorni, Helsinki El, LT Anu Vaajanen Mikä tauti on glaukooma? Näköhermon etenevä sairaus, joka aiheuttaa vaurioita näköhermon

Lisätiedot

Geenitutkimuksista. Potilasopas. Kuvat: Rebecca J Kent www.rebeccajkent.com rebecca@rebeccajkent.com

Geenitutkimuksista. Potilasopas. Kuvat: Rebecca J Kent www.rebeccajkent.com rebecca@rebeccajkent.com 12 Geenitutkimuksista Muokattu allamainittujen instanssien julkaisemista vihkosista, heidän laatustandardiensa mukaan: Guy's and St Thomas' Hospital, London, United Kingdom; Huhtikuussa 2008 Tätä työtä

Lisätiedot

Asiakastiedote 26/2014

Asiakastiedote 26/2014 Arvoisa asiakas, Asiakastiedote Sivu 1/5 Muutoksia reniini- ja aldosteronimäärityksiin sekä uusi tutkimus Aldosteroni-reniini, suhde fp-reniini, konsentraatio fp-reninm ATK 22100 P -Reniini, konsentraatio

Lisätiedot

Tuhkarokko Euroopassa ja Yhdysvalloissa

Tuhkarokko Euroopassa ja Yhdysvalloissa Tuhkarokko Euroopassa ja Yhdysvalloissa - mikä suoja suomalaisilla? Tartuntatautikurssi 15.4.2015 15.4.2015 Virusinfektiot-yksikkö/ Mia Kontio 1 Tuhkarokko: epäíly ja varmistus Oireet 7-21 vrk tartunnasta:

Lisätiedot

Lapsi ja nuori syöpäpotilaana. Carea, Kymenlaakson Syöpäyhdistys, Sylva Toivo Salmi 20.3.2014

Lapsi ja nuori syöpäpotilaana. Carea, Kymenlaakson Syöpäyhdistys, Sylva Toivo Salmi 20.3.2014 Lapsi ja nuori syöpäpotilaana Carea, Kymenlaakson Syöpäyhdistys, Sylva Toivo Salmi 20.3.2014 Lasten ja nuorten syöpä, lukumäärät 0-14 vuotiaat n.150 uutta tapausta vuosittain 15-24 vuotiaat n. 140 uutta

Lisätiedot

9.12.2010 Dnro 2712/03.01.01/2010

9.12.2010 Dnro 2712/03.01.01/2010 Ohje 2/2010 1 (5) 9.12.2010 Dnro 2712/03.01.01/2010 Lääkkeiden haittavaikutusten ilmoittaminen Kohderyhmät Lääkkeen määräämiseen tai toimittamiseen oikeutetut henkilöt Voimassaoloaika Ohje tulee voimaan

Lisätiedot

Proscar. 7.8.2015, versio 3.0 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO

Proscar. 7.8.2015, versio 3.0 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO Proscar 7.8.2015, versio 3.0 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO VI.2 JULKISEN YHTEENVEDON OSIOT VI.2.1 Tietoa sairauden esiintyvyydestä Eturauhanen on ainoastaan miehillä oleva rauhanen. Eturauhanen

Lisätiedot

PredictAD-hanke Kohti tehokkaampaa diagnostiikkaa Alzheimerin taudissa. Jyrki Lötjönen, johtava tutkija VTT

PredictAD-hanke Kohti tehokkaampaa diagnostiikkaa Alzheimerin taudissa. Jyrki Lötjönen, johtava tutkija VTT PredictAD-hanke Kohti tehokkaampaa diagnostiikkaa Alzheimerin taudissa Jyrki Lötjönen, johtava tutkija VTT 2 Alzheimerin taudin diagnostiikka Alzheimerin tauti on etenevä muistisairaus. Alzheimerin tauti

Lisätiedot

Syöpäseulontojen perusteet ja suolistosyöpäseulonnan tulokset matkalla kuntia velvoittavaksi toiminnaksi

Syöpäseulontojen perusteet ja suolistosyöpäseulonnan tulokset matkalla kuntia velvoittavaksi toiminnaksi Syöpäseulontojen perusteet ja suolistosyöpäseulonnan tulokset matkalla kuntia velvoittavaksi toiminnaksi Yhteyshoitajakoulutus 29.9.2011 Nea Malila Suomen Syöpärekisteri ja Tampereen yliopisto Milloin

Lisätiedot

Sydänpurjehdus 8.10.2013. Sepelvaltimotauti todettu - Milloin varjoainekuvaus, pallolaajennus tai ohitusleikkaus? Juhani Airaksinen TYKS, Sydänkeskus

Sydänpurjehdus 8.10.2013. Sepelvaltimotauti todettu - Milloin varjoainekuvaus, pallolaajennus tai ohitusleikkaus? Juhani Airaksinen TYKS, Sydänkeskus Sydänpurjehdus 8.10.2013 Sepelvaltimotauti todettu - Milloin varjoainekuvaus, pallolaajennus tai ohitusleikkaus? Juhani Airaksinen TYKS, Sydänkeskus Oireet RasitusEKG - CT Sepelvaltimoiden varjoainekuvaukset

Lisätiedot

GREYHOUNDIEN TERVEYSKARTOITUS 2012

GREYHOUNDIEN TERVEYSKARTOITUS 2012 GREYHOUNDIEN TERVEYSKARTOITUS 2012 Hyvä Greyhoundin omistaja! Tarkoituksenamme on kartoittaa v. 2002 ja sen jälkeen syntyneiden koirien tiedot, myös terveiden ja jo kuolleiden koirien osalta. Koiran nimen

Lisätiedot

Miten uudet verenkuvan viitearvot toimivat. Pirkko Lammi 2004

Miten uudet verenkuvan viitearvot toimivat. Pirkko Lammi 2004 Miten uudet verenkuvan viitearvot toimivat Pirkko Lammi 2004 Lähtökohdat Jotta sairaus voidaan erottaa terveydestä laboratoriolääketieteen keinoin, on tiedettävä, millaisia arvoja terveet henkilöt saavat.

Lisätiedot

HARVINAISEN SAIRAUDEN YHDISTYS MUKANA HARVINAISESSA KATTOJÄRJESTÖSSÄ. Katri Karlsson Suomen HAE-yhdistyksen puheenjohtaja

HARVINAISEN SAIRAUDEN YHDISTYS MUKANA HARVINAISESSA KATTOJÄRJESTÖSSÄ. Katri Karlsson Suomen HAE-yhdistyksen puheenjohtaja HARVINAISEN SAIRAUDEN YHDISTYS MUKANA HARVINAISESSA KATTOJÄRJESTÖSSÄ Katri Karlsson Suomen HAE-yhdistyksen puheenjohtaja SISÄLLYS - HAE eli hereditäärinen angioödeema - Mikä on Suomen HAE-yhdistys? - Miten

Lisätiedot

Liite I. Tieteelliset johtopäätökset ja perusteet myyntilupien ehtojen muuttamiselle

Liite I. Tieteelliset johtopäätökset ja perusteet myyntilupien ehtojen muuttamiselle Liite I Tieteelliset johtopäätökset ja perusteet myyntilupien ehtojen muuttamiselle Tieteelliset johtopäätökset Kun otetaan huomioon lääketurvallisuuden riskinarviointikomitean (PRACin) arviointiraportti

Lisätiedot

RhD-negatiivisten äitien raskaudenaikaisen anti-d-suojausohjelman laajeneminen sekä synnyttäjän verensiirtoon varautuminen ja immunisaatiotutkimukset

RhD-negatiivisten äitien raskaudenaikaisen anti-d-suojausohjelman laajeneminen sekä synnyttäjän verensiirtoon varautuminen ja immunisaatiotutkimukset HELSINGIN JA UUDENMAAN SAIRAANHOITOPIIRI 142014 RhD-negatiivisten äitien raskaudenaikaisen anti-d-suojausohjelman laajeneminen sekä synnyttäjän verensiirtoon varautuminen ja immunisaatiotutkimukset Asia

Lisätiedot

PYLL-seminaari 30.3.2011

PYLL-seminaari 30.3.2011 PYLL-seminaari 30.3.2011 Sairaalajohtaja Jari Välimäki syöpätautien osuus ennenaikaisten elinvuosien menetysten aiheuttajina etenkin ESshp:n naisten keskuudessa kiinnittää huomiota ne ovat PYLL-tilastossa

Lisätiedot

KKK-HHS / Pointterijaos Terveystiedustelu 1. ääniherkkä (esim. ilotulitus, ukkonen) paukkuarka (esim. laukaus)

KKK-HHS / Pointterijaos Terveystiedustelu 1. ääniherkkä (esim. ilotulitus, ukkonen) paukkuarka (esim. laukaus) 1 Koiran nimi Rekisterinumero Syntymäaika Sukupuoli 1. Luonne Kuvaile koirasi luonnetta omin sanoin Uros Narttu Väri Onko koirasi Koirasi suhtautuminen ääniherkkä (esim. ilotulitus, ukkonen) paukkuarka

Lisätiedot

Mihin vaikeasti vammaisten hoidon rajoituspäätökset perustuvat ja kuka päättää?

Mihin vaikeasti vammaisten hoidon rajoituspäätökset perustuvat ja kuka päättää? Mihin vaikeasti vammaisten hoidon rajoituspäätökset perustuvat ja kuka päättää? Tuula Lönnqvist Lastenneurologian dosentti HYKS LNS Neurologian toimiala / Lastenneurologian konsultaatioyksikkö Seminaari:

Lisätiedot

Muistisairaana kotona kauemmin

Muistisairaana kotona kauemmin Muistisairaana kotona kauemmin Merja Mäkisalo Ropponen Terveystieteiden tohtori, kansanedustaja Muistiliitto ry:n hallituksen puheenjohtaja Nykytilanne Suomessa sairastuu päivittäin 36 henkilöä muistisairauteen.

Lisätiedot

PRE-EKLAMPSIAN YLLÄTTÄESSÄ RASKAANA OLEVAN NAISEN

PRE-EKLAMPSIAN YLLÄTTÄESSÄ RASKAANA OLEVAN NAISEN PRE-EKLAMPSIAN YLLÄTTÄESSÄ RASKAANA OLEVAN NAISEN Marianne Isopahkala Pre-eklampsiaan sairastuneelle MITÄ PRE-EKLAMPSIA ON? Pre-eklampsiasta on käytetty vanhastaan nimityksiä raskausmyrkytys ja toksemia.

Lisätiedot