Mitokondriosairauksissa aktivoituvia geenejä tunnistettu. Heikki Eräsalo Ohjaajat: FM Esko Kemppainen ja prof. Howard Jacobs BIOKEMIA

Koko: px
Aloita esitys sivulta:

Download "Mitokondriosairauksissa aktivoituvia geenejä tunnistettu. Heikki Eräsalo Ohjaajat: FM Esko Kemppainen ja prof. Howard Jacobs BIOKEMIA"

Transkriptio

1 Mitokondriosairauksissaaktivoituviageenejätunnistettu HeikkiEräsalo Ohjaajat:FMEskoKemppainenjaprof.HowardJacobs BIOKEMIA Mitokondrioperäiset sairaudet aiheuttavat laajan kirjon oireita ihmisillä. Oireisiin kuuluu esimerkiksi hermoston, aineenvaihdunnan häiriöt ja lihaskato sekä - heikkous. Tiedetään, että mitokondrioperäiset sairaudet aktivoivat suuren joukon geenejä, jotka auttavat potilasta selviämään. Tutkimuksessa tunnistettiin kolme geeniä jotka aktivoituivat mitokondriosairauden vuoksi ja saatiin uutta tietoa näiden geenien säätelymekanismeista. Lisäksi löydettiin useita solun sisäisestä viestinnästä vastaavaavia molekyylejä jotka ovat osallisena näiden geenien aktivoitumisessa.tämäantaauuttatietoamitokondriosairauksienmekanismeistaja rakentaapohjaatulevaisuudenhoitojenkehitykselle. Työssä hyödynnettiin banaanikärpäsmallia, jossa ilmenee samanlaiset oireet kuin ihmisilläkin ja mallisairauden taustamekanismi on sama kuin ihmisillä. Banaanikärpäsmallia hyödyntämällä voitiin suorittaa tutkimuksia, jotka ihmispotilaillaolisivatmahdottomiasuorittaa.tätämalliahyödyntämällälöydettiin geenejä, joiden vastineet löytyvät myös ihmisiltä ja jotka erittäin todennäköisesti aktivoituvat myös ihmisellä vastaavanlaisessa sairaustilassa. Tätä mallia hyödyntämällävoidaantulevaisuudessatuottaaentistäenemmäntietouttaihmisen sairauksistajamahdollisestilopultamyösparantaane. 1

2 Uudestadiagnostiikkalaitteestaapukehitysmaidenterveydenhuoltoon? RistoHanninen Ohjaajat:FMEtviJuntunen,TeppoSalminen,FTTeroSoukka,FTKimPettersson, DIDineshKumarjaFTNavinKhanna BIOTEKNIIKKADI Diplomityossa kehitettiin laitetta, joka soveltuu erityisesti kehitysmaiden diagnostiikkatarpeisiin. Laitteella luetaan lateraalivirtauslastuja, joissa on kaytetty leima-aineina upkonvertoivia loisteainepartikkeleita (UCP). Alustavat tulokset laitekehityksesta ovaat lupaavia, mutta prototyyppilaitten kehitys on viela kesken. Laitteella on tarkoitus pystya suorittamaan la hestulkoon mita tahansa diagnostiikkatestejakustannustehokkaasti. Laitteesta pyrittiin kehitta ma yksinkertainen, suorituskyvysta tinkima tta Yksinkertaisuus tuo huomattavia kustannussasto ja joka on tarkea erityisesti kehitysmaiden markkinoilla. Lateraalivirtauslastut mahdollistavat ma rityksen yksinkertaisen suorittamisen, UCP-partikkelit itse lukijalaitteen yksinkertaisen toiminnan. 2

3 Painolastivedenkäsittelyjärjestelmientestaamisessaonpuutteita? VilleKaataja Ohjaajat:DIMarkkuHelamaa,AuramarineOyjaFMMarkusVehniainen,Turun yliopisto,biotekniikka BIOTEKNIIKKADI Diplomityo tarkoituksena oli selvitta millaisia ongelmia painolastivedenka sittelyja rjestelmien testaamisessa saattaa esiintya Tuloksien perusteella painolastivedenkasittelyjarjestelma voivat toimia vaaditulla tavalla testiolosuhteissa, mutta eiva valttamatta niille tarkoitetussa meriymparisto ssa Vara positiivinen tulos saattaa johtaa painolastivedenkasittelyjarjestelmien alimitoittamiseen ja nain ollen tuhansien toimimattomien jarjestelmien asentamiseen. Painolastivetta kayteta laivojen tasapainottamiseen ja riittava uintisyvyyden saavuttamisen Painolastiveden mukana siirtyneet vieraselio ovat aiheuttaneet merkittavia ekologisia ja taloudellisia ongelmia jo vuosien ajan. Vuonna 2004 kansainva linen merenkulkujarjesto (IMO) hyvaksyi painolastivesia koskevan sopimuksen, jonka mukaan laivojen tulee puhdistaa painolastivetensa ennen sen purkuasatamiin.sopimuksenodotetaanastuvanvoimaanvuonna2013.seuraavan kymmenen vuoden aikana noin laivaa tulee varustaa painolastinpuhdistusjarjestelmilla Se merkitsee miljardien kokonaismarkkinoita puhdistusjarjestelmienvalmistajille. 3

4 Ihmisenvakavankehitysvammaisuudenaiheuttavaaproteiiniavoidaan tuottaakärpässoluissa HenriikkaKentala Ohjaajat:FTElisePintajaFTdos.PirkkoHeikinheimo BIOKEMIA Ihmisen vakavaan perinno lliseen kehitysvammaisuuteen liittyva CLN5-proteiinia tuotettiin karpassoluissa hetkellisessa tuottosolulinjassa, seka muodostamalla pysyva tuottosolulinja. Myo hemmin tutkittiin naiden kahden eri menetelma tehokkuutta proteiinituottoon. Tutkimuksessa selvisi, etta hetkellinen solulinja tuotti suuremman ma ra proteiinia solua kohti. Tulevaisuudessa on tarkoitus tuottaa ihmisen CLN5-proteiinia rakennetutkimuksiin, jonka avulla pyrita selvittama CLN5-proteiininnormaalitehtavasoluissa. CLN5-proteiinin perinno llisesta geenimutaatiosta seuraa ihmiselle vakava lapsuusia kehitysvammaisuus, joka kuuluu harvinaisiin lysosomaalisiin kertyma sairauksiin. Tautiin ei ole olemassa parantavaa lakehoitoa, minka vuoksi potilaat menehtyva noin kolmenkymmenen vuoden ikaisina CLN5-proteiinin normaalia tehtava soluissa ei tunneta, mutta sen tiedeta liittyva lysosomien toimintaan. Lysosomeja voidaan kuvailla solujen puhtaanapitolaitoksiksi, koska niidentehtava onhajottaasolunvanhojajaviallisiaosia.kunlysosomiteiva CLN5- geenin mutaation seurauksena toimi normaalisti, hajotettavaksi tarkoitettu materiaali kertyy ihmisessa mm. hermokudokseen, mika on syyna potilaiden kehitysvammaisuudenaiheuttavaanaivojenrappeutumiseen. Proteiinintehtavavoidaanyrittaselvittakolmiulotteisenrakenteenavulla,koska proteiinin toiminta perustuu usein sen oikeanlaiseen laskostumiseen. Rakenteen maritysta varten tarvitaan runsaasti puhdasta proteiinia ja siksi sita varten vaaditaan toimiva menetelma proteiinin tuottamiseksi. CLN5-proteiinin solunsisaisen tehtava selvittaminen toisi edistysaskeleen toimivien la kehoitojen kehitystyohon. Lisaksi se voisi edesauttaa muiden lysosomaalisten kertyma sairauksien profilointia, koska CLN5:n tiedeta vuorovaikuttavan solussa muidencln-proteiinienkanssa. 4

5 Coronaryarterydiseasediagnosticswithupconvertingnanoparticles(UCNPs) StevenKirkham Supervisors:M.Sc.RiikkaArppeandM.Sc.Marja-LeenaJärvenpää MOLECULARBIOTECHNOLOGYANDDIAGNOSTICS Upconvertingnanoparticles(UCNPs)arearound20-30nmindiameterandhave unique ability to radiate visible light when exposed to infrared (IR) light, called upconversion. Before the unique optical properties can be utilised in diagnostic assays, the surface of the nanoparticles needs to be activated. However, the small particle size creates problems in thesurface coating process as previous washing methods,suchascentrifugation,cannolongerbeusedduetothepooryieldofthe particles.thisworkhasfocuseduponoptimisingtheantibodycoatingoftheucnps andthenutilisingthesecoateducnpsaslabelsinanassayforsubstancefoundin human blood circulation during heart muscle damage, e.g. in coronary artery disease,cardiactroponin(ctni). Priortoantibodycoating,theUCNPsurfacewasactivatedtoenablewatersolubility and the ability of the particle to bind, e.g. to proteins. Thereafter, the anti-ctni antibodywasattachedto thesurface. Theantibody binding conditions,amountof antibody,andthewashingstepsofthereactionwereoptimisedtoimprovebinding capacityandyield.twofiltertubeswithdifferentfiltermembranes(300khadlarger pores,100ksmallerpores)andalsonewmagneticseparationmethodweretested. ctniassaywasthenusedtodetermineucnpsignalstrength,signaltobackground ratio,sensitivity,andnon-specificbinding. Thehighestyieldofantibody-coatedUCNPswasobtainedwiththe100kfilter (around100%).themagneticseparationmethodand300kfiltergavemuchlower yields(29%and21%,respectively).inthectniassay,allparticletypeshadsignal levelswhichincreasedasctniamountincreased.however,theydidn tworkwellat lower ctni concentrations. Thus further improvements such as more efficient blockingoftheparticlesurfaceandoptimisationofthebuffercontentsareneeded toincreaseucnpfunctionality. 5

6 Pikatestinkehittäminenvirtsanäytteillehengitystieinfektioiden diagnostiikkaan JuhaMattiKoskinen Ohjaaja:FTJanneO.Koskinen,ArcDiaInternationalOyLtd MOLEKULAARINENBIOTEKNIIKKAJADIAGNOSTIIKKA maripoc on infektiotautien osoittamiseen kehitetty taysin automatisoitu testijarjestelma jossa tunnistetaan useita taudinaiheuttajia samanaikaisesti ja nopeasti.tassaprogradu-tyo ssakehitettiinmaripoc -testijarjestelma pikatesti, jossahengitystieinfektiontaudinaiheuttajaosoitetaanvirtsanaytteesta. maripoc hyo dynta turkulaista koeputkitestauksen laser-teknologiaa. Myynnissa olevat testit on tarkoitettu hengitystieinfektioiden testaukseen nenanielusta tai nielusta otetusta nukkatikkunaytteesta Tyo tavoitteena oli tutkia uuden laserteknologian soveltuvuutta virtsanaytteiden pikatestaukseen seka kehitta legionellanjapneumokinvirtsastatunnistavattestit. Virtsasta todetun hengitystieinfektion taudinaiheuttajan oletetaan kertovan elimisto sisaisesta infektiosta ja olevan siten vahemma altis kantajuuden aiheuttamillekliinisestimerkityksettomilleloydo ksille.virtsanaytteenottaminenon yksinkertainentoimenpidetoisinkuinverinaytteenotto. Uusiamahdollisuuksiakeuhkokuumeendiagnostiikkaan Tulosten mukaan automatisoitu maripoc -pikatesti mahdollistaisi myo virtsanaytteidenlaboratoriotasoisenanalysoimisenkeuhkokuumepotilailtanopeasti ja tehokkaasti hoitopaikalla. Laser-teknologian todettiin kompensoivan muille testeille ongelmallisia ha irio tekijo ita Kompensoinnin ansiosta metodologian tarkkuusonkorkeaverrattunamarkkinajohtajanpikatestiin. 6

7 Kohtiluotettavampaadenguekuumediagnostiikkaa EricaKuusela Ohjaajat:Ph.D.GauravBatrajaFTUrpoLamminmaki MOLEKULAARINENBIOTEKNIIKKAJADIAGNOSTIIKKA Erikoistyo ssa valmistettiin geenifragmenttikirjasto, joka voi auttaa denguekuumediagnostiikan parantamista huomattavasti. Lisaksi tyo tulokset voivat edesauttaa rokotekehitysta Denguekuume on flaviviruksiin kuuluvan dengueviruksenaiheuttamatauti,jolleeitoistaiseksiolerokotettaeika diagnostiikkaa,joka antaisi luotettavan tuloksen. Nopea ja luotettava diagnostiikka on tarpeen tehokkaan hoidon mahdollistamiseksi. Ongelmana diagnostiikan kehityksessa on ollut denguevirustartunnan erottaminen muista flavivirustartunnoista, silla flavivirukset ja niiden aiheuttamat oireet ovat hyvin samanlaisia. Lisaksi denguevirustaonneljaalatyyppiajotkakaikkidiagnostiikanpitaisipystyatunnistamaan. Tyo tavoitteenaoliselvittamitka virusproteiinienosatalatyyppi1:nrakenteessa aiheuttavatihmisellaimmuunivasteen. Geenifragmenttikirjasto valmistettiin liittamalla dengueviruksen alatyyppi 1:n geenipalasia bakteeriviruksen genomiin. Na in saadaan tuotettua bakteeriviruksia, joiden pinnalle kyseiset geenipalat koodaavat erilaisia virusproteiinien osia. Geenifragmenttikirjasto sisalta miljoonia tallaisia bakteeriviruksia. Kirjastosta etsittiin alatyyppi 1:lle tyypillisia aminohappoketjuja, joihin dengue-virusta tunnistavat vasta-aineet sitoutuvat. Kaytetyt vasta-aineet olivat peraisin denguekuumepotilaan verinaytteesta Tulokset osoittivat, etta kirjaston valmistus onnistui, ja etta kirjasto toimii suunnitellusti. Tutkimukset verinaytteilla ovat kesken,muttaalustavattuloksetovatolleetlupaavia. 7

8 Viljattomanruokavalionvaikutuksestatyypindiabeteksessa LindaLauren Ohjaajat:FTRaineToivonenjaLTArnoHanninen BIOKEMIA Tutkimusryhmassamme on ennen todettu viljattoman ruokavalion vahentava tyypin diabeteksen (T1D) esiintyvyytta T1D:n hiirimallilla. Haima on suoraan yhteydessa ruuansulatuskanavaan, ja ruokavaliotekijo iden uskotaan vaikuttavan T1D:n syntyyn yhdessa suolistobakteerien kanssa. T1D:ssa elimisto puolustusjarjestelma tulehdussolut tuhoavat haimasaarekkeiden insuliinia tuottavat solut. Tyypin diabetes (T1D) on yleinen sairaus Suomessa ja sen esiintyvyysonlisa ntynytmaailmanlaajuisestivuosittain. Erikoistyo ssa kaytetylle hiirimallille kehittyy ihmisen tautia vastaava T1D. Hiiria ruokittiin viljattomalla erikoisruokavaliolla seka viljaa sisaltavalla perusruokavaliolla.seitsenviikkoisiltahiirilta kera ttiinhaima,ohutsuolenloppuosa ja paksusuoli. Haimansaarekkeet erotettiin muusta haimakudoksesta laserleikkaukseen perustuvalla menetelmalla Haimasaarekkeista seka ohut- ja paksusuolesta maritettiin tekijo ita jotka kertovat elinten tulehdusvasteesta ja vasteentulehdussoluistasekana idensatelysta. Myo erikoistyo tulokset viittaavat viljattoman ruokavalion T1D:lta suojaavaan vaikutukseen. Haimasaarekkeiden tulehdusvaste vaikuttaa viljattomalla ruokavaliolla vahentava tulehdusta perusruokavalioon verrattuna. Ohut- ja paksusuolentulehdusvasteetovatyhtenevajanayttavamolemmillaruokavalioilla tulehdusta va hentavilta Viljattoman ruokavalion tulehdusvaste on kuitenkin perusruokavaliota korkeampi, mika voi kertoa tama suojaavan tulehdukselta ja T1D:ltaperusruokavaliotaenemman. 8

9 Hampaankiinnityskudostentulehdustaaiheuttavabakteerisitookeskeistä tulehduksenvälittäjäainetta ElinaLohermaa Ohjaajat:FMAnnamariPainojaFTRiikkaIhalin BIOKEMIA Aggregatibacter actinomycetemcomitans-bakteeri aiheuttaa hampaan kiinnityskudosten tulehdusta (parodontiitti). Tutkimuksessa havaittiin, etta tallainen elinkykyinen bakteeri sitoo keskeista tulehduksenvalittajaainetta interleukiini (IL)-1ß:a. Lisaksi havaittiin, etta elinkykyisen bakteerin lasnaollessa ikenen solujen jakautuminen vahenee. Tutkimuksessa kaytettiin ienkudosta jaljitteleva kudosviljelymallia, joka koostui ihmisen ikenen soluista. Kudosviljelymalliaaltistettiinbakteerinmuodostamalleyhdyskunnalleelibiofilmille antibiootinkanssajailmanantibioottia. Biofilmitovatbakteerien muodostamia jarjestaytyneitayhteisoja jotkaaiheuttavat ihmisilla kroonisia tulehduksia vastustamalla isanna puolustusmekanismeja seka antibiootteja. Joidenkin biofilmeja muodostavien bakteerien on myo havaittu sitovantulehduksenvalittajaaineita.terveessahammastaympa ro ivassakudoksessa keskeinentulehduksenvalitta ja aineil-1ßedista solujenjakautumista. Sitomalla tulehduksenvalittajaainetta bakteeri saattaa heikenta ihmisen puolustusjarjestelma toimintaa paikallisesti seka mahdollisesti esta eraiden solujenjakautumista.na idenvuorovaikutustenosoittaminenvaatiivielatarkempia lisatutkimuksia. 9

10 Uudenmääritystekniikanhyödyntäminensydäninfarktindiagnostiikassa EevaMalmi Ohjaaja:FMHennaPakkila MOLEKULAARINENBIOTEKNIIKKAJADIAGNOSTIIKKA Sydaninfarktin aikana vaurioituneesta sydanlihaksesta vapautuu verenkiertoon useita normaalisti ainoastaan sydanlihaksessa esiintyvia proteiineja, joiden pitoisuutta voidaan tutkia verinaytteesta vaurion tunnistamiseksi. Yksi tallainen proteiini on sydanpera inen troponiini I, jonka havaitseminen veresta on selva merkkisydanlihaksen vaurioitumisesta. Tasta syystasen pitoisuuden mittaaminen verinaytteestaonkinnormaalitoimenpidesydaninfarktidiagnoosinvarmistamiseksi. Sydaninfarktin kuten monien muidenkin sairauksien diagnostiikassa testitulosten nopea saaminen saattaa olla potilaan kannalta elintarkea ja tasta syysta diagnostisiatestejapyritakehitta majatkuvastinopeammiksi.nopeudenlisaksi on tarkea etta marityksen herkkyys eli pienin havaittavissa oleva kohdemolekyylipitoisuus on riittava alhainen. Nopeiden ja samalla mahdollisimmanherkkienma ritystenkehittaminenonkuitenkinhaaste. Useissa diagnostisissa testeissa kohdemolekyylin havaitseminen perustuu leimaaineista mitattavaan valoon, jonka avulla voidaan tarkasti ma ritta tutkittavan kohdemolekyylin pitoisuus naytteessa Parempien leima-aineiden ja leimateknologioiden kehitys on yksi monista mahdollisuuksista saavuttaa marityksissaentista parempiherkkyysjanopeus. Tyo tavoitteena on osoittaa biotekniikan osastolla kehitetyn uudenlaisen leimateknologianluomatmahdollisuudetherkajanopeansydanperaistatroponiini I:ta tunnistavan marityksen kehittamiseksi. Onnistuessaan tyo edista diagnostiikan kehitysta ja mahdollistaa menetelma hyo dyntamisen myo muiden sairauksiendiagnostiikassa. 10

11 Vaihtoehtoisiamenetelmiäprobioottienelävyydenmäärittämiseen LeenaMattsson Ohjaajat:FTJuhaLappalainenjaFMMarkusVehniainen BIOTEKNIIKKADI Probiootit ovat eläviä mikro-organismeja, joilla on riittävässä määrin nautittuna terveydelle hyödyllisiä vaikutuksia. Probioottien elävyyttä arvioitiin adenosiinitrifosfaatin (ATP) määrään perustuen, laskemalla maljalla kasvavia pesäkkeitä, mikroskopoinnilla sekä värjäysmenetelmällä. ATP:n määrän mittauksella tulos saataisiin useita päiviä perinteistä maljausmenetelmää nopeammin. Myös jakaantumiskyvyttömät, mutta metabolisesti aktiiviset solut voidaan havaita ATP:n avulla. Tällaisilla soluilla saattaa olla samanlaisia probioottisiaterveysvaikutuksiakuinjakaantumiskykyisilläkinsoluilla. ATP:n mara perustuva mittaus sopi probiootin kasvun seuraamiseen liuosviljelyssa Kylma kuivatuille probiooteille ei standardisoitua menetelma onnistuttu kehittaman, silla havaittavan ATP:n mara vaihteli solujen kunnon, kannan, tuotantomenetelmien ja sailytyksen mukaan. Menetelmalla pystyta kuitenkinmahdollisestiseuraamaanyksittaisentuotteenaktiivisuudenvahenemista sa ilytyksenaikana. 11

12 c-flipproteiininfosforylaationvaikutust-auttajasolujenerilaistumiseen JohannaMyllyviita Ohjaajat:FMMinnaKyläniemijaprof.RiittaLahesmaa BIOKEMIA Erikoistyössä tutkittiin c-flip proteiinin lyhyen muodon (c-flips) fosforylaation vaikutusta T-auttajasolujen (Th-solujen) erilaistumiseen. Th-solut ovat tärkeä osa ihmisen immuunipuolustusta. Ne jakautuvat ainakin kahdeksi alaluokaksi: Th1- ja Th2-soluiksiriippuensolunkohtaamistasytokiineista.Myöskaspaasiaktiivisuudella on todettu olevan merkitys Th-solujen erilaistumisessa. Kaspaasi-8-proteiinin aktiivisuudenestämisenontodettulisäävänth2-solujentuottamanil4:nmäärääja Th2-solujen erilaistumista. Kaspaasiaktiivisuutta säätelevät monet tekijät mm. c- FLIP-proteiinineriisomuodot. c-flips:n stabiilisuutta sadella proteiinin fosforylaation avulla. Tyo ta varten proteiinistaon tehty kaksi mutaatiota,stabiloiva ja epastabiloiva, jotka kloonattiin plasmidiin. Plasmidit transfektoitiin periferaalisesta veresta eristettyihin T- auttajasoluihin. Solujen erilaistumista ja fosforyloinnin vaikutusta siihen tutkittiin erilaistenmenetelmienavulla. Erilaistumistatutkittiinkayttaenerilaistumismarkkereita,jotkaovatspesifisia joko Th1-taiTh2-soluille.Tutkimushypoteesinmukaanoletettiin,ettac-FLIPsproteiinin stabiloivamutaatioohjaasolujaenemmath2-suuntaankuinepastabiilimutaatio. Tama varmistamiseksitarvitaankuitenkinlisatutkimuksia. 12

13 Useanproteiinintutkiminensamastasyöpäkudosnäytteestä PetraMaki-Teeri Ohjaajat:FTTeijoPellinenjaFMRiina-MinnaVananen BIOTEKNIIKKADI Tyo ssakehitettiinmenetelma jonkaavullapystytatutkimaan useita proteiineja samanaikaisesti yhdesta syo pa kudosnaytteesta Tata menetelma voidaan kaytta hyo dyksi eri proteiinien vaikutussuhteiden tutkimisessa. Ta lla kahden erilaisen varjaysmenetelma ja multispektraalikuvantamisen yhdistelmalla saatiin selville, etta eturauhassyo pakudoksessa kahdella proteiinilla fosfo-akt:lla ja mieshormonireseptorillaonvaikutustoisiinsa. Aktiivisellamieshormonireseptorillaonmerkittava vaikutuseturauhassyo pasolujen kasvuun. Eturauhassyo pa hoidetaan estamalla mieshormonien sitoutuminen kohdereseptoriinsa, mutta tasta huolimatta joissakin tapauksissa syo pa uusiutuu. Toinen proteiini, fosfo-akt, on usein koholla naissa uusiutuneissa syovissa Tutkimuksen tarkoituksena oli tutkia mieshormonireseptorin ja fosfo-akt:n ilmentymistaeturauhassyo pakudoksissa. Tyo ssa kaytettiin kuvaustekniikkaa, jossa tutkittavasta kudosnaytteesta otetaan kuviauseallakymmenellavaloneriaallonpituudella. Ta ma antaapaljontarkempaa tietoa naytteen vareista verrattuna normaaliin varikuvaukseen, jossa kayteta kolmeaeriaallonpituusaluetta-punaista,vihrea jasinista(rgb).kunnaytteeneri komponenttien tarkat va rit tiedeta n, pystyta tietokoneohjelman avulla koko naytteesta erottelemaan naiden yksitta isten varien voimakkuudet. Eturauhassyo pakudoksessa olevat tutkittavat proteiinit varjattiin tavallisilla tai fluoresoivilla vareilla Tavallista varia havainnoidaan nakyva valon avulla, mutta fluoresoiva vari nahda vain UV-sateilyn avulla. Tama mahdollistaa useamman proteiinin tarkastelemisen samanaikaisesti, silla naiden kahden eri varjaysmenetelmavariteivasekoitutoisiinsa. 13

14 EPA:njaDPA:nsaantiravinnostamuidenomega-sarjanrasvahappojen rinnallaontärkeää AnuNuora Ohjaajat:FTKaisaLinderborgjaprof.HeikkiKallio ELINTARVIKEKEMIA Tutkimuksessa, jossa tutkittiin omega -sarjan rasvahappojen aterianja lkeisia vaikutuksiaihmisessasaatiinlisanaytto sille,ettaepa:njadpa:nsaantiravinnosta muiden omega -sarjan rasvahappojen rinnalla on tarkea Tutkimustulokset osoittavatettaravinnostasaatuepajadpanostavatepa:njadpa:nma ra aterian jalkeenyhdestaviiteentuntiin.pidemma aikavalintutkimuksiaihmisillakuitenkin tarvitaan, jotta nahda vaikuttavatko ravinnosta saadun EPA:n ja DPA:n mara positiivisestimyodha:nmaraihmisessaepa:n,dpa:njadha:nontodettu olevan edullisia ihmisen terveydelle. Niiden sanno llisen kayto on mm. todettu alentavankolesteroliajaparantavanmuistia. Perinteisesti EPA:n, DPA:n ja DHA:n aineenvaihduntaa ihmisessa on tutkittu sisa llyttama lla ateriohin kalao ljya tai hylkeen ljya Koska luonnon ljyt kuitenkin ovat rasvahappojen seoksia, on pelkasta ravinnosta saadun EPA:n tai DPA:n tai DHA:nvaikutustatoisiinsaollutvaikeatulkita.Myoskalyhyempienomega sarjanrasvahappojenmuuttumista pidemmiksi, kuten DHA:ksi, eiollavoitusulkea poistuloksista.tamaerikoistyotarkoituksenaolitutkiajaverrataepa:njadpa:n aterianjalkeista aineenvaihduntaa ihmisissa kun kaytossa oli puhdasta EPA:a ja puhdastadpa:tasisaltavatestiaamiaiset. Tutkimuksessa 10 vapaaehtoista koehenkilo so kukin kolme erilaista aamiaista. Kontrolliaamiainen,johonkahdestamuustaaamiaisestasaatujatuloksiaverrattiin, sisa lsi20oliivi ljya Kaksi muutaaamiaistasisalsiva18oliivi ljyajajoko EPA:ataiDPA:ta.Syo misenjalkeenkoehenkilo iltaotettiinverinaytteitatunninvalein yhdesta viiteen tuntiin. Veressa rasva kuljetetaan kylomikroneissa, jotka ovat oikeastaa veressa kulkevia rasvapisaroita. Na ma rasvapisarat eristettiin verinaytteistajaniidensisaltamarasvaanalysoitiintutkimuksessa. 14

15 Proteiininrakenneantaatietoasenstereospesifisyydestä PasiPaananen Ohjaajat:Ph.D.LailaNiiranenjaFTMikkoMetsa-Ketela BIOKEMIA Erikoistyo ssa selvitettiin landomysiinien reaktiotiehen liittyva entsyymi LanV:n atomitason rakenne rontgenkristallografian avulla. Tasta proteiinirakenteesta saatiin kolme erilaista mallia: proteiinin oman tuotteen 11-deoksilandomysinonin kanssa, tama kaltaisen rabelomysiinin kanssa, seka rakenne ilman naita Tama lisaksi kaikissa rakenteissa oli sitoutuneena entsyymin reaktioon osallistuva, siina kofaktorinatoimiva,nikotiiniamidiadeniinidinukleotidifosfaatti(nadp)-molekyyli. Landomysiinit kuuluvat angusykliineihin, bioaktiivisiin maaperabakteerien tuottamiin sekundaariaineenvaihdunnallisiin tuotteisiin. Angusykliineja ei toistaiseksi ole la kekayto ssa kuten joitain muita niiden kaltaisia molekyyleja Landomysiinien erikoispiirre on niiden 6-hiilen stereokemia, jonka muodostumisesta LanV vastaa. Proteiinirakenteista pystyttiin selvitta ma alue johon proteiinin muokkaama molekyyli sitoutuu, mitka proteiinin aminohapoista sitoutumiseen osallistuu, seka missa asennossa sen oma tuote ja ta ma kaltainen molekyyli sitoutuu alueeseen. Na ita tietoja voidaan kaytta pohjana suunnittelutyossa kun yriteta muokata entsyymin stereokemiaa uusien bioaktiivistenmolekyylientuottamiseksi. 15

16 Bakteerienhavainnointiverestäverenmyrkytyksessä MatleenaPunkkinen Ohjaajat:FMAriLehmusvuori,FMMariaNordin,FTPelleOhlssonja FTSaaraWittfooth BIOTEKNIIKKADI Kun taudin aiheuttavia bakteereita etsita veresta on tarkea etteiva veren ainesosat hairitse bakteerien havainnointia. Tutkimuksessa todettiin, etteiva tata aiheuttaneet veri, punasolut eika veriplasma tarpeeksi laimennettuina. Pienten solumarien saavuttamiseksi punasoluja voitiin poistaa bakteereja sisaltavasta verestailman,ettabakteeritkin poistuivat.ta matehtiin akustoforeesiksikutsutulla tekniikalla,jossapunasolujaohjattiinultraanenavulla. Yksisairauksista,jotkavoidaantunnistaaverestaloydettyjenmikrobienperusteella, onverenmyrkytyselisepsis.siinamikrobittunkeutuvatkehoonjaaiheuttavatkehon laajuisentulehduksen.verenmyrkytysonvakava,useinkuolemaanjohtavasairausja yksiyleisimmista sairaaloissa tapahtuvienkuolemiensyista Sentunnistaminen on vaikeaa,sillasenoireetmuistuttavatesimerkiksiinfluenssanoireita. Verenmyrkytyksenjasenaiheuttamanmikrobinnopeatunnistaminenonkuitenkin tarkeasillakuolemantodennako isyysnouseeverenmyrkytyksessahyvinnopeasti, ja laajakaytto isten antibioottien kayttaminen johtaa antibiooteille vastustuskykyisten bakteerien mara lisa ntymiseen. Tama takiatutkimuksessa autettiinkehittamanopeaabakteerientunnistusmenetelma verenmyrkytykseen. 16

17 Magneettejavoidaankäyttäänanopartikkelienerotteluun OskariSalovaara Ohjaajat:FTTerhiRiuttamäki,FMRiikkaArppejaprof.TeroSoukka BIOTEKNIIKKADI Diplomityossa kehitettiin magnetismiin perustuva erottelumenetelma joka mahdollistaa upkonvertoivien nanopartikkelien (lyh. UCNP) erottelun muista materiaaleista. Menetelma on nopeampi ja valikoivampi kuin perinteiset suodatukseenpohjautuvatsysteemit.erottelumenetelma perustuuhavaintoon,etta UCNP:t ovat magneettikentassa magnetisoituvia niiden sisaltamien lantanidien vuoksi. Lantanidit saavat aikaan UCNP-partikkelien ainutlaatuiset loisteominaisuudet, joiden takia ne ovat viime aikoina herattaneet suurta mielenkiintoadiagnostiikka-jabiokuvantamisaloilla. Magnetismiinperustuvaerottelumenetelma ottaamalliakaivosteollisuudesta,jossa vastaava menetelma on ollut kaytossa jo pitka eroteltaessa magneettisia malmipartikkeleita kaivoslietteesta Diplomityo ssa kehitetyssa menetelmassa neodyymikestomagneeteilla muodostettua magneettikentta saadaan vahvistettua magnetisoituvalla verkkomaisella rakenteella, joka koostuu yksinkertaisimmillaan esimerkiksi ruostumattomasta terasvillasta. Vahvistettu magneettikentta on niin voimakas,ettaseriittasitomaanucnp:ta,kunnejohdetaanverkkorakenteenlapi liuosmuodossa. Kun magneettikentta poistetaan, saadaan UCNP-partikkelit huuhdottuatalteenlaitteistosta. Jotta UCNP:ta voidaan hyo dynta diagnostiikkasovelluksissa, niiden pinta pita aktivoida useassa eri reaktiossa. Kussakin vaiheessa UCNP-liuokseen ja paljon ylima ra istamateriaalia,jokahairitseepartikkelienkaytto sovelluksissa.magneetti erottelumenetelma voidaan kaytta esimerkiksi eroteltaessa vasta-aineisiin kiinnitettyja UCNP:ta reaktioliuokseen ja neista vapaista vasta-aineista ja muista pinnoituskemikaaleista. Magneettikentta vaikuttaa vain UCNP-partikkeleihin ja kaikki ylima raiset ei-magneettiset pinnoituskemikaalit huuhtoutuvat pois erottelulaitteistosta.menetelma avulla voidaanmyokonsentroidanaytteita seka vaihtaa niita liuoksesta toiseen. Erottelukapasiteetin kasvattaminen vaatii viela lisatutkimuksia. 17

18 Entsyyminrakenteenvaikutusreaktionlopputuotteeseen LinneaSamila Ohjaajat:FTPauliKalliojaFTMikkoMetsa-Ketela BIOKEMIA Työssä tutkittiin AknH- ja SnoaL-entsyymeitä, jotka katalysoivat samankaltaisia reaktioitaantibioottiensynteesissä.työssätutkittiiinnäidenentsyymienrakenteen vaikutusta reaktion lopputuotteeseen vaihtamalla entsyymien osia keskenään. Tulokseksi saatiin, ettei yhden alueen vaihtaminen muuta lopputuotetta alkuperäisestä,vaantarvitaantodennäköisestikahdenalueenvaihto. Työssä tutkitut entsyymit osallistuvat luonnossa bakteerien tuottamien antibioottien tuotantoon. Tutkimalla näitä entsyymejä saadaan lisää tietoa niiden katalysoimista reaktioista ja miten niitä voitaisiin hyödyntää lääketeollisuuden käytössä.tulevaisuudessaonmahdollistasuunnitellauusiaantibioottejajatuottaa niitäuusillasuunnitelluillaentsyymeillä. 18

19 Lisäämahdollisuuksiasyövänkuvantamiseen HenriSipilä Ohjaajat:FMPauliinaLuoto,FTHarriTakalojaprof.AnneRoivainen BIOTEKNIIKKADI Tyo tarkoituksenaolikuvata puhdastilanjaanalyysimenetelmienvalidointi osana [ 68 Ga]-leimattujen radiolakkeiden tuotannon pystytysta Turun PET-keskuksessa. [ 68 Ga]radiolakeaineetovatuusiaSuomessajanetuovatlisamahdollisuuksiamuun muassa syova diagnostiikkaan. Tyo seurauksena saatujen tulosten perusteella puhdastilassa voitiin aloittaa kliiniseen kaytto tarkoitettujen [ 68 Ga]radiolakkeiden valmistaminen ja analyysimenetelma voitiin ottaa kaytto tuotannonlaadunvarmistuksessa. Positroniemissiotomografia(PET)onisotooppikuvantamisenmuoto, joka perustuu positronisateilijo iden kaytto merkkiaineena. Positroneja emittoiva radionuklidi liiteta biologisestiaktiiviseenyhdisteeseenkemiallisellasynteesilla Valmistuote, radiolakeaine, annostellaan potilaan verenkiertoon ja sen kulkeutumista elimistossa seurataan PET-kameralla. Kasvainten hoidossa PET-kuvasta saatavaa informaatiota voidaan kaytta apuna esimerkiksi kirurgisen operaation suunnittelussaseka hoidonseurannassa. 19

20 LateraalivirtausmääritysHIV-jahepatiitti-infektioidenhavaitsemiseen AnniSpangar Ohjaajat:FMEtviJuntunenjaprof.KimPettersson MOLEKULAARINENBIOTEKNIIKKAJADIAGNOSTIIKKA Erikoistyössä tutkittiin ja kehitettiin lateraalivirtaukseen perustuvaa määritystä HIV- ja hepatiitti B-infektioiden havaitsemiseen yhdestä näytteestä. Määrityksessä käytetytmerkkiaineetovathyvinerilaisia.hiv-määrityksessätunnistetaaninfektion aiheuttamaa immuunivastetta, eli virusta vastaan muodostuneita vasta-aineita. Hepatiitti -määrityksessä tunnistuskohteena puolestaan on hepatiitti - viruspartikkelinpinnallaesiintyväantigeeni. Lateraalivirtausmäärityksiä käytetään yleisesti pikatesteinä ja ne ovat helppokäyttöisiä ja edullisia, joten ne sopivat hyvin potilasläheiseen testaukseen esimerkiksikehittyvissämaissa.hepatiitti-virusjahi-virus(hiv)ovatveriteitse tarttuvia viruksia, jonka vuoksi on tärkeää seuloa esimerkiksi luovutettu veri infektioiden havaitsemiseksi. Onnistuneella monianalyyttimäärityksellä pystytään saamaan enemmän tietoa samasta näytteestä kuin yhtä analyyttia mittaavalla määrityksellä ilman, että määrityksen analyyttinen suorituskyky kärsii merkittävästi. 20

21 Edullisellaautomaatiollavauhtiatuotantoon ErnoSundberg Ohjaajat:FMTomPalenius,AbacusDiagnosticaOyjaFMAriLehmusvuori BIOTEKNIIKKADI GenomEra -testilastujen tuotantokapasiteetti on mahdollista kaksinkertaistaa edullisellaautomaatioratkaisulla. Automatisoinnillaonmahdollista saavuttaamyo merkittavia kustannussa sto ja GenomEra -testilastut ovat Abacus Diagnostica Oy:nDNA-pohjaisidiagnostisiatestejainfektiosairauksille. Tuotantoprosessinanalysoinnissahavaittiintuotannossaolevanpullonkauloja,jotka rajoittavat tuotantoa. Diplomityo ssa havaittiin pahimmaksi ongelmakohdaksi testilastujen merkitseminen. Tyo aikana selvitettiin erilaisia menetelmia testilastujenmerkitsemiseen.lupaavinvaihtoehtooliautomaattinenetiketo intilaite, joka kiinnitta isi etiketit automaattisesti jokaiseen testilastuun. Etiketo intilaitteella saavutettavat kustannussasto maksaisivat etiketo intilaitteen takaisin noin vuodessa. Diplomityo perusteella tuotannon laajamittaisella analysoinnilla, ja analysoinnin perusteella tehdylla kehitystyo lla pystyta tuotantokapasiteettia kasvattamaan merkittavastivarsinpienillakininvestoinneilla. 21

Pellavansiemenen. 6/2009 Hyvinvointia pellavasta -hanke

Pellavansiemenen. 6/2009 Hyvinvointia pellavasta -hanke Pellavansiemenen terveysvaikutukset Kooste Lähteenä käytetty artikkelia TarpilaA, WennbergT. TarpilaS: Flaxseedas a functionalfood. Current Topics in Neutraceutical Research 2005 (3);3:167-188 1 Sisällysluettelo

Lisätiedot

Diabetes (sokeritauti)

Diabetes (sokeritauti) Diabetes (sokeritauti) Lääkärikirja Duodecim Pertti Mustajoki, sisätautien erikoislääkäri Diabeteksessa eli sokeritaudissa veren sokerimäärä on liian korkea. Lääkäri tai hoitaja mittaa verensokerin verinäytteestä

Lisätiedot

NUORET TUTKIJAT 2012

NUORET TUTKIJAT 2012 NUORET TUTKIJAT 2012 Biokemia Elintarvikekemia Molekulaarinen biotekniikka ja diagnostiikka Biotekniikka DI NUORET TUTKIJAT 2012 Eräsalo Heikki Hänninen Risto Kaataja Ville Kentala Henriikka Kirkham Steven

Lisätiedot

RUOANSULATUS JA SUOLISTON KUNTO. Iida Elomaa & Hanna-Kaisa Virtanen

RUOANSULATUS JA SUOLISTON KUNTO. Iida Elomaa & Hanna-Kaisa Virtanen RUOANSULATUS JA SUOLISTON KUNTO Iida Elomaa & Hanna-Kaisa Virtanen Edellisen leirin Kotitehtävä Tarkkaile sokerin käyttöäsi kolmen päivän ajalta ja merkkaa kaikki sokeria ja piilosokeria sisältävät ruuat

Lisätiedot

5.2.2010 Labquality-päivät / Jaana Leiviskä 1

5.2.2010 Labquality-päivät / Jaana Leiviskä 1 Apolipoproteiinit p p metabolisen häiriön ennustajina Jaana Leiviskä, THL Labquality-päivät 5.2.2010 5.2.2010 Labquality-päivät / Jaana Leiviskä 1 Energiatasapaino i Energian saanti = energian kulutus

Lisätiedot

Ihmiskeho. Ruoansulatus. Jaana Ohtonen Kielikoulu/Språkskolan Haparanda. söndag 16 februari 14

Ihmiskeho. Ruoansulatus. Jaana Ohtonen Kielikoulu/Språkskolan Haparanda. söndag 16 februari 14 Ihmiskeho Ruoansulatus Ruoansulatus Keho voi ottaa talteen ja käyttää hyvin pieniä molekyylejä. Useimmat ravintoaineet ovat suuria molekyllejä. Ravintoaineet on hajotettava pieniksi osasiksi ennen kuin

Lisätiedot

Autoimmuunitaudit: osa 1

Autoimmuunitaudit: osa 1 Autoimmuunitaudit: osa 1 Autoimmuunitaute tunnetaan yli 80. Ne ovat kroonisia sairauksia, joiden syntymekanismia eli patogeneesiä ei useimmissa tapauksissa ymmärretä. Tautien esiintyvyys vaihtelee maanosien,

Lisätiedot

Humuksen vaikutukset järvien hiilenkiertoon ja ravintoverkostoihin. Paula Kankaala FT, dos. Itä Suomen yliopisto Biologian laitos

Humuksen vaikutukset järvien hiilenkiertoon ja ravintoverkostoihin. Paula Kankaala FT, dos. Itä Suomen yliopisto Biologian laitos Humuksen vaikutukset järvien hiilenkiertoon ja ravintoverkostoihin Paula Kankaala FT, dos. Itä Suomen yliopisto Biologian laitos Hiilenkierto järvessä Valuma alueelta peräisin oleva orgaaninen aine (humus)

Lisätiedot

KandiakatemiA Kandiklinikka

KandiakatemiA Kandiklinikka Kandiklinikka Kandit vastaavat Immunologia Luonnollinen ja hankittu immuniteetti IMMUNOLOGIA Ihmisen immuniteetti pohjautuu luonnolliseen ja hankittuun immuniteettiin. Immunologiasta vastaa lymfaattiset

Lisätiedot

Sylvant (siltuksimabi) RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO

Sylvant (siltuksimabi) RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO EMA/198014/2014 Sylvant (siltuksimabi) RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO Tämä on Sylvant-valmistetta koskevan riskienhallintasuunnitelman yhteenveto, jossa esitetään toimenpiteet, joiden

Lisätiedot

KEESHONDIEN MONIMUOTOISUUSKARTOITUS

KEESHONDIEN MONIMUOTOISUUSKARTOITUS KEESHONDIEN MONIMUOTOISUUSKARTOITUS 2 3. 0 1. 2 0 1 1 K A A R I N A Marjut Ritala DNA-diagnostiikkapalveluja kotieläimille ja lemmikeille Polveutumismääritykset Geenitestit Serologiset testit Kissat, koirat,

Lisätiedot

Biologia. Pakolliset kurssit. 1. Eliömaailma (BI1)

Biologia. Pakolliset kurssit. 1. Eliömaailma (BI1) Biologia Pakolliset kurssit 1. Eliömaailma (BI1) tuntee elämän tunnusmerkit ja perusedellytykset sekä tietää, miten elämän ilmiöitä tutkitaan ymmärtää, mitä luonnon monimuotoisuus biosysteemien eri tasoilla

Lisätiedot

Vastaa lyhyesti selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan

Vastaa lyhyesti selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan 1 1) Tunnista molekyylit (1 piste) ja täytä seuraava taulukko (2 pistettä) a) b) c) d) a) Syklinen AMP (camp) (0.25) b) Beta-karoteeni (0.25 p) c) Sakkaroosi (0.25 p) d) -D-Glukopyranoosi (0.25 p) 2 Taulukko.

Lisätiedot

E Seleeni 7000 plex. Tärkeitä antioksidantteja ja orgaanista seleeniä

E Seleeni 7000 plex. Tärkeitä antioksidantteja ja orgaanista seleeniä E Seleeni 7000 plex Tärkeitä antioksidantteja ja orgaanista seleeniä KOOSTUMUS E-vitamiini 7 000 mg/kg B6-vitamiini B12-vitamiini C-vitamiini Sinkki (Zn) Seleeni (Se) 60 % natriumseleniittinä 40 % orgaanisena

Lisätiedot

Omevio. Välttämättömiä rasvahappoja lemmikin ihon terveyden edistämiseen. UUTUUS iholle ja turkille. Lemmikin hyvinvoinnin tueksi

Omevio. Välttämättömiä rasvahappoja lemmikin ihon terveyden edistämiseen. UUTUUS iholle ja turkille. Lemmikin hyvinvoinnin tueksi Omevio Välttämättömiä rasvahappoja lemmikin ihon terveyden edistämiseen UUTUUS iholle ja turkille Mitä välttämättömät rasvahapot ovat? Välttämättömät rasvahapot ovat koirien ja kissojen ihon terveyttä

Lisätiedot

Eeva Kuusela Itä-Suomen yliopisto

Eeva Kuusela Itä-Suomen yliopisto Eeva Kuusela Itä-Suomen yliopisto Maitotuotteita on arvosteltu suhteellisen korkean tyydyttyneiden rasvahappopitoisuuden vuoksi, jotka liitetään sydänja verisuonitauteihin Viime aikoina maito on tunnustettu

Lisätiedot

Ravitsemus, terveys ja Suomen luonnosta saadut tuotteet. Raija Tahvonen

Ravitsemus, terveys ja Suomen luonnosta saadut tuotteet. Raija Tahvonen Ravitsemus, terveys ja Suomen luonnosta saadut tuotteet Raija Tahvonen Terveellinen ruokavalio on kasvivoittoinen Runsaasti: Kasviksia, marjoja ja hedelmiä Viljatuotteet pääosin täysjyväviljaa Kalaa ja

Lisätiedot

Probiotic 12. PRO12-koostumus saatavana vain LR:ltä! P R O B I OO TT I NEN RAVINTOLISÄ

Probiotic 12. PRO12-koostumus saatavana vain LR:ltä! P R O B I OO TT I NEN RAVINTOLISÄ Probiotic 12 PRO12-koostumus saatavana vain LR:ltä! P R O B I OO TT I NEN RAVINTOLISÄ Probiotic 12 Mitä ovat probiootit? MITÄ OVAT PROBIOOTIT? Ihmisen suolistossa on miljoonittain bakteereja Nämä bakteerit

Lisätiedot

Syöpä. Ihmisen keho muodostuu miljardeista soluista. Vaikka. EGF-kasvutekijä. reseptori. tuma. dna

Syöpä. Ihmisen keho muodostuu miljardeista soluista. Vaikka. EGF-kasvutekijä. reseptori. tuma. dna Ihmisen keho muodostuu miljardeista soluista. Vaikka nämä solut ovat tietyssä mielessä meidän omiamme, ne polveutuvat itsenäisistä yksisoluisista elämänmuodoista, jotka ovat säilyttäneet monia itsenäisen

Lisätiedot

Suolisto ja vastustuskyky. Lapin urheiluakatemia koonnut: Kristi Loukusa

Suolisto ja vastustuskyky. Lapin urheiluakatemia koonnut: Kristi Loukusa Suolisto ja vastustuskyky Lapin urheiluakatemia koonnut: Kristi Loukusa Suoliston vaikutus terveyteen Vatsa ja suolisto ovat terveyden kulmakiviä -> niiden hyvinvointi heijastuu sekä fyysiseen että psyykkiseen

Lisätiedot

Luonnonmarjat ja kansanterveys. Raija Tahvonen MTT/BEL

Luonnonmarjat ja kansanterveys. Raija Tahvonen MTT/BEL Luonnonmarjat ja kansanterveys Raija Tahvonen MTT/BEL 15.8.2013 Jos poimit marjat itse, saat Liikuntaa Luonnossa liikkumisen hyvät vaikutukset aivoille Marjasi tuoreena Varman tiedot, mistä marjat ovat

Lisätiedot

K&V kasvattajaseminaari 16.10.2005 Marjukka Sarkanen

K&V kasvattajaseminaari 16.10.2005 Marjukka Sarkanen An update on the diagnosis of proteinuria in dogs Oct 1, 2003 By: Johanna Frank, DVM, Dipl. ACVIM PLN: Vioittuneet munuaiskeräset (glomerulus) laskevat veren proteiinin (albumiini) virtsaan. Syitä: glomerulonefriitti

Lisätiedot

TaLO-tapaukset Virusoppi. Vastuuhenkilöt: Tapaus 1: Matti Varis Tapaus 2: Veijo Hukkanen Tapaus 3: Sisko Tauriainen Tapaus 4: Ilkka Julkunen

TaLO-tapaukset Virusoppi. Vastuuhenkilöt: Tapaus 1: Matti Varis Tapaus 2: Veijo Hukkanen Tapaus 3: Sisko Tauriainen Tapaus 4: Ilkka Julkunen TaLO-tapaukset Virusoppi Vastuuhenkilöt: Tapaus 1: Matti Varis Tapaus 2: Veijo Hukkanen Tapaus 3: Sisko Tauriainen Tapaus 4: Ilkka Julkunen TaLO-tapaus 1 Uusi uhkaava respiratorinen virusinfektio Tapaus

Lisätiedot

Liikunta. Terve 1 ja 2

Liikunta. Terve 1 ja 2 Liikunta Terve 1 ja 2 Käsiteparit: a) fyysinen aktiivisuus liikunta b) terveysliikunta kuntoliikunta c) Nestehukka-lämpöuupumus Fyysinen aktiivisuus: Kaikki liike, joka kasvattaa energiatarvetta lepotilaan

Lisätiedot

Säteilyvaikutuksen synty. Erikoistuvien lääkärien päivät 25 26.1.2013 Kuopio

Säteilyvaikutuksen synty. Erikoistuvien lääkärien päivät 25 26.1.2013 Kuopio Säteilyvaikutuksen synty Erikoistuvien lääkärien päivät 25 26.1.2013 Kuopio Säteilyn ja biologisen materian vuorovaikutus Koska ihmisestä 70% on vettä, todennäköisin (ja tärkein) säteilyn ja biologisen

Lisätiedot

GEENITEKNIIKAN PERUSASIOITA

GEENITEKNIIKAN PERUSASIOITA GEENITEKNIIKAN PERUSASIOITA GEENITEKNIIKKKA ON BIOTEKNIIKAN OSA-ALUE! Biotekniikka tutkii ja kehittää elävien solujen, solun osien, biokemiallisten menetelmien sekä molekyylibiologian uusimpien menetelmien

Lisätiedot

PUHDISTAA POISTAA MYRKKYJÄ TUKEE RUOANSULATUS- JÄRJESTELMÄÄ. ATeamSuomi.com merenheimo@gmail.com 1

PUHDISTAA POISTAA MYRKKYJÄ TUKEE RUOANSULATUS- JÄRJESTELMÄÄ. ATeamSuomi.com merenheimo@gmail.com 1 PUHDISTAA POISTAA MYRKKYJÄ TUKEE RUOANSULATUS- JÄRJESTELMÄÄ merenheimo@gmail.com 1 PUHDISTAA KEHOA Tehokas yhdistelmä ravintoaineita tehostavat suoliston toimintaa ja tukevat suolistossa jo olevia hyödyllisiä

Lisätiedot

Uusi lähestymistapa varhaisen Alzheimerin taudin ravitsemushoitoon. Potilasopas

Uusi lähestymistapa varhaisen Alzheimerin taudin ravitsemushoitoon. Potilasopas Uusi lähestymistapa varhaisen Alzheimerin taudin ravitsemushoitoon Potilasopas Alzheimerin taudin oireet Alzheimerin taudin ensimmäinen oire on yleensä päivittäisten tapahtumien unohtuminen. Usein muistetaan

Lisätiedot

Jardiance-valmisteen (empagliflotsiini) riskienhallintasuunnitelman (RMP) yhteenveto

Jardiance-valmisteen (empagliflotsiini) riskienhallintasuunnitelman (RMP) yhteenveto EMA/188850/2014 Jardiance-valmisteen (empagliflotsiini) riskienhallintasuunnitelman (RMP) yhteenveto Tämä on Jardiance-valmisteen riskienhallintasuunnitelman yhteenveto, jossa esitetään toimenpiteet, joilla

Lisätiedot

Bakteereja tunnistetaan a) muodon perusteella:

Bakteereja tunnistetaan a) muodon perusteella: Bakteereja tunnistetaan a) muodon perusteella: ja b) värjäytyvyyden perusteella: 1) Gram-positiiviset Soluseinän ulkokalvo värjäytyy 2) Gram negatiiviset Soluseinän ulkokalvo jää värjäytymättä Laborointi

Lisätiedot

SUKLAA JA SYDÄNTERVEYS

SUKLAA JA SYDÄNTERVEYS SUKLAA JA SYDÄNTERVEYS terveystuote vai haitallinen herkku? Jaakko Mursu, TtM,, ravitsemusterapeutti Ravitsemusepidemiologian jatko opiskelija opiskelija Kansanterveyden tutkimuslaitos, Kuopion yliopisto

Lisätiedot

Tyypin 2 diabetes - mitä se on?

Tyypin 2 diabetes - mitä se on? - mitä se on? sokeriaineenvaihdunnan häiriö usein osa metabolista oireyhtymää vahvasti perinnöllinen kehittyy hitaasti ja vähin oirein keski-ikäisten ja sitä vanhempien sairaus? elintavoilla hoidettava

Lisätiedot

Olen saanut tyypin 2 diabeteksen

Olen saanut tyypin 2 diabeteksen Bolujem od dijabetesa tip 2 Olen saanut tyypin 2 diabeteksen Kysymyksiä ja vastauksia Pitanja i odgovori Mitä diabetekseen sairastuminen merkitsee? On täysin luonnollista, että diabetekseen sairastunut

Lisätiedot

Arvokkaiden yhdisteiden tuottaminen kasveissa ja kasvisoluviljelmissä

Arvokkaiden yhdisteiden tuottaminen kasveissa ja kasvisoluviljelmissä Arvokkaiden yhdisteiden tuottaminen kasveissa ja kasvisoluviljelmissä Siirtogeenisiä organismeja käytetään jo nyt monien yleisten biologisten lääkeaineiden valmistuksessa. Esimerkiksi sellaisia yksinkertaisia

Lisätiedot

Viekirax-valmisteen (ombitasviiri/paritapreviiri/ritonaviiri) riskienhallintasuunnitelman yhteenveto

Viekirax-valmisteen (ombitasviiri/paritapreviiri/ritonaviiri) riskienhallintasuunnitelman yhteenveto EMA/775985/2014 Viekirax-valmisteen (ombitasviiri/paritapreviiri/ritonaviiri) enhallintasuunnitelman yhteenveto Tämä on Viekirax-valmisteen enhallintasuunnitelman yhteenveto, jossa esitetään toimenpiteet,

Lisätiedot

AJATTELE ITSEÄSI, TOIMI. POSITIIVISIN KEINOIN diabeteksen hallintaan

AJATTELE ITSEÄSI, TOIMI. POSITIIVISIN KEINOIN diabeteksen hallintaan AJATTELE ITSEÄSI, TOIMI POSITIIVISIN KEINOIN diabeteksen hallintaan Mikä on diabetes? Diabetes on tila, jossa elimistön on vaikea muuttaa nautittua ravintoa energiaksi Diabeteksessa veressä on liikaa glukoosia

Lisätiedot

Cosentyx-valmisteen (sekukinumabi) riskienhallintasuunnitelman yhteenveto

Cosentyx-valmisteen (sekukinumabi) riskienhallintasuunnitelman yhteenveto EMA/775515/2014 Cosentyx-valmisteen (sekukinumabi) riskienhallintasuunnitelman yhteenveto Tämä on Cosentyx-valmisteen riskienhallintasuunnitelman yhteenveto, jossa esitetään toimenpiteet, joilla varmistetaan,

Lisätiedot

ASEA. Maailman ensimmäinen ja ainoa redoxsignalointimolekyyli valmiste. Mitä ovat redoxsignalointimolekyylit?

ASEA. Maailman ensimmäinen ja ainoa redoxsignalointimolekyyli valmiste. Mitä ovat redoxsignalointimolekyylit? ASEA Maailman ensimmäinen ja ainoa redoxsignalointimolekyyli valmiste Mitä ovat redoxsignalointimolekyylit? Kaikissa kehon soluissa on mitokondrioita, jotka ovat solujen voimanlähde. Mitokondriot erittävät

Lisätiedot

Herne lisää lehmien maitotuotosta

Herne lisää lehmien maitotuotosta Liite 13.6.2005 62. vuosikerta Numero 2 Sivu 6 Herne lisää lehmien maitotuotosta Seppo Ahvenjärvi, Aila Vanhatalo ja Seija Jaakkola, MTT Märehtijät saavat herneestä hyvin valkuaistäydennystä silloin, kun

Lisätiedot

UUSI LÄHESTYMISTAPA VARHAISEN ALZHEIMERIN TAUDIN RAVITSEMUSHOITOON POTILASOPAS

UUSI LÄHESTYMISTAPA VARHAISEN ALZHEIMERIN TAUDIN RAVITSEMUSHOITOON POTILASOPAS UUSI LÄHESTYMISTAPA VARHAISEN ALZHEIMERIN TAUDIN RAVITSEMUSHOITOON POTILASOPAS ALZHEIMERIN TAUDIN OIREET Alzheimerin taudin ensimmäinen oire on yleensä päivittäisten tapahtumien unohtuminen. Usein muistetaan

Lisätiedot

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan 1. a) Mitä tarkoitetaan biopolymeerilla? Mihin kolmeen ryhmään biopolymeerit voidaan jakaa? (1,5 p) Biopolymeerit ovat luonnossa esiintyviä / elävien solujen muodostamia polymeerejä / makromolekyylejä.

Lisätiedot

Lepakkorabiestutkimus

Lepakkorabiestutkimus Lepakkorabiestutkimus Lepakkoseminaari 19.3.2011 Esitelmän rakenne Tietoa rabieksesta ja lepakkorabieksesta Tutkimushanke Miten voit osallistua hankkeeseen Mitä lepakkoharrastajan ja -tutkijan on hyvä

Lisätiedot

FINDRI REF- TECHNOLOGY. Findri Ref-Control. Lauhduttimien ja nesteja a hdyttimien puhaltimien seka pumppujen ohjauskeskus

FINDRI REF- TECHNOLOGY. Findri Ref-Control. Lauhduttimien ja nesteja a hdyttimien puhaltimien seka pumppujen ohjauskeskus Findri Ref-Control Lauhduttimien ja nesteja a hdyttimien puhaltimien seka pumppujen ohjauskeskus Kohteeseen kuin kohteeseen optimoitavat Findri Ref-Control -ohjauskeskukset Oy Yleiskylma -Findri tarjoaa

Lisätiedot

Johdanto omega-3-rasvahappoihin. Mitä eroa on kala-omegoilla ja kasvi-omegoilla?

Johdanto omega-3-rasvahappoihin. Mitä eroa on kala-omegoilla ja kasvi-omegoilla? Johdanto omega-3-rasvahappoihin Mitä eroa on kala-omegoilla ja kasvi-omegoilla? Rasvat ja öljyt koostuvat rasvahapoista Erityyppisiä rasvahappoja: 1. Tyydyttyneet rasvahapot, yleisimmät: palmitiini- (C16:0)

Lisätiedot

TÄS ON PROTSKUU! Missä yhteyksissä olet törmännyt sanaan proteiini tai valkuaisaine?

TÄS ON PROTSKUU! Missä yhteyksissä olet törmännyt sanaan proteiini tai valkuaisaine? TÄS ON PROTSKUU! KOHDERYHMÄ: Työ soveltuu parhaiten yläkouluun kurssille elollinen luonto ja yhteiskunta, sekä lukioon kurssille KE1. KESTO: Työ koostuu kahdesta osasta: n. 30 min/osa. MOTIVAATIO: Mitä

Lisätiedot

Nivelreuman serologiset testit: mitä ne kertovat? LT, apulaisylilääkäri Anna-Maija Haapala TAYS Laboratoriokeskus

Nivelreuman serologiset testit: mitä ne kertovat? LT, apulaisylilääkäri Anna-Maija Haapala TAYS Laboratoriokeskus Nivelreuman serologiset testit: mitä ne kertovat? LT, apulaisylilääkäri Anna-Maija Haapala TAYS Laboratoriokeskus Sisältö 1. Nivelreuma: etiologia, esiintyvyys, diagnostiikka 2. Nivelreuman serologiset

Lisätiedot

NivelTeho. 120 kaps. 32,90. (ovh. 40,70) 411,25 e/kg

NivelTeho. 120 kaps. 32,90. (ovh. 40,70) 411,25 e/kg NivelTeho Liiku nivelet lempeästi kuntoon. Kuuden tutkitun aktiiviaineen yhdistelmä: MSM, inkivääriuute, glukosamiini, hainrusto, kupari ja C-vitamiini. 120 kaps. 32,90 411,25 e/kg (ovh. 40,70) Luontainen

Lisätiedot

Sydän- ja verisuoni sairaudet. Tehnyt:Juhana, Sampsa, Unna, Sanni,

Sydän- ja verisuoni sairaudet. Tehnyt:Juhana, Sampsa, Unna, Sanni, Sydän- ja verisuoni sairaudet Tehnyt:Juhana, Sampsa, Unna, Sanni, - Yli miljoona suomalaista sairastaa sydän-ja verisuoni sairauksia tai diabetesta. - Näissä sairauksissa on kyse rasva- tai sokeriaineenvaihdunnan

Lisätiedot

Vahvasta vasikasta tuottavaksi naudaksi. Vasikoiden kasvatus. jbs portfolio. jbs:n kanssa

Vahvasta vasikasta tuottavaksi naudaksi. Vasikoiden kasvatus. jbs portfolio. jbs:n kanssa Vahvasta vasikasta tuottavaksi naudaksi Vasikoiden kasvatus jbs portfolio jbs:n kanssa jbs kälberpaste - vasikkatahna Lyhyesti taattu korkea taso immunoglobuliinia (johdettu IBR-vapaasta maidosta) sisältää

Lisätiedot

Eturauhassyövän kuvantaminen lääkekehityksessä

Eturauhassyövän kuvantaminen lääkekehityksessä Eturauhassyövän kuvantaminen lääkekehityksessä Helena Ahtinen Ohjaajat: FT Saija Savolainen, prof. Anne Roivainen BIOKEMIA Lääkeaineen kudoshakuisuus on keskeisessä osassa uusia lääkeaineita kehiteltäessä.

Lisätiedot

Terveellinen kaura. Lumoudu kaurasta Kaurapäivä 1.10.2013. Kaisa Mensonen Leipätiedotus ry

Terveellinen kaura. Lumoudu kaurasta Kaurapäivä 1.10.2013. Kaisa Mensonen Leipätiedotus ry Terveellinen kaura Lumoudu kaurasta Kaurapäivä 1.10.2013 Kaisa Mensonen Leipätiedotus ry Mikä on Leipätiedotus? Leipomoalan yhteinen tiedotusyksikkö Perustettu 1961 Rahoitus Perusbudjetti jäsenmaksuista

Lisätiedot

SELKÄYDINNESTEEN PERUSTUTKIMUKSET

SELKÄYDINNESTEEN PERUSTUTKIMUKSET Käyttöönottopäivä: 21.11.2011 1 (5) SELKÄYDINNESTEEN PERUSTUTKIMUKSET Atk-numero ja -lyhenne 1154 Li-BaktVi 1470 Li-Gluk 2186 Li-Laktaat 2514 Li-Prot 2655 Li-Solut 4059 Li-Syto Likvorin irtosolututkimus

Lisätiedot

Paremman elämän puolesta

Paremman elämän puolesta Paremman elämän puolesta MSD toimii paremman elämän puolesta, suomalaisen potilaan parhaaksi. Meille on tärkeää, että jokainen lääkehoitoa tarvitseva saa juuri hänelle parhaiten sopivan hoidon. Me MSD:llä

Lisätiedot

PCR - tekniikka elintarvikeanalytiikassa

PCR - tekniikka elintarvikeanalytiikassa PCR - tekniikka elintarvikeanalytiikassa Listerian, Salmonellan ja kampylobakteerien tunnistus elintarvikkeista ja rehuista 29.11.2012 Eva Fredriksson-Lidsle Listeria monocytogenes Salmonella (spp) Campylobacter

Lisätiedot

GLUTEENIANALYTIIKKA KELIAKIAN KANNALTA. Viljateknologien Helmikollokvio Hartwall, Lahti 8.2.2008 Päivi Kanerva

GLUTEENIANALYTIIKKA KELIAKIAN KANNALTA. Viljateknologien Helmikollokvio Hartwall, Lahti 8.2.2008 Päivi Kanerva GLUTEENIANALYTIIKKA KELIAKIAN KANNALTA Viljateknologien Helmikollokvio Hartwall, Lahti 8.2.2008 Päivi Kanerva Gluteenittomuus Gluteenittomia tuotteita koskevan standardin on asettanut Codex Alimentarius

Lisätiedot

Geneettisen tutkimustiedon

Geneettisen tutkimustiedon Geneettisen tutkimustiedon omistaminen Tutkijan näkökulma Katriina Aalto-Setälä Professori, sisätautien ja kardiologian erikoislääkäri Tampereen Yliopisto ja TAYS Sydänsairaala Etiikan päivät 9.3.2016

Lisätiedot

FORMARE 2015. Ravinnon merkitys hyvinvoinnille - ja ohjeet terveelliseen ruokavalioon

FORMARE 2015. Ravinnon merkitys hyvinvoinnille - ja ohjeet terveelliseen ruokavalioon FORMARE 2015 Ravinnon merkitys hyvinvoinnille - ja ohjeet terveelliseen ruokavalioon Sisältö Kalorit ja kulutus Proteiini Hiilihydraatti Rasva Vitamiinit Kivennäis- ja hivenaineet Vesi ja nesteytys Ravintosuositukset

Lisätiedot

Polar Pharma Oy Kyttäläntie 8 A 00390 Helsinki. puh. 09 8493 630 info@polarpharma.fi www.polarpharma.fi

Polar Pharma Oy Kyttäläntie 8 A 00390 Helsinki. puh. 09 8493 630 info@polarpharma.fi www.polarpharma.fi Polar Pharma Oy Kyttäläntie 8 A 00390 Helsinki puh. 09 8493 630 info@polarpharma.fi www.polarpharma.fi Suomen vanhin urheilujuoma, joka kehitettiin 80-luvulla. Alun perin Suomen suurimman virvoitusjuomien

Lisätiedot

JÄTEHUOLLON ERIKOISTYÖ

JÄTEHUOLLON ERIKOISTYÖ Jari-Jussi Syrjä 1200715 JÄTEHUOLLON ERIKOISTYÖ Typpioksiduulin mittaus GASMET-monikaasuanalysaattorilla Tekniikka ja Liikenne 2013 1. Johdanto Erikoistyön tavoitteena selvittää Vaasan ammattikorkeakoulun

Lisätiedot

TERVEELLINEN RAVITSEMUS OSANA ARKEA

TERVEELLINEN RAVITSEMUS OSANA ARKEA TERVEELLINEN RAVITSEMUS OSANA ARKEA Mitä kaikkea terveellinen ravinto on? Terveellinen ravinto Terveellisestä ruokavaliosta saa sopivasti energiaa ja tarvittavia ravintoaineita Terveellinen ravinto auttaa

Lisätiedot

Syö muistisi hyväksi

Syö muistisi hyväksi Syö muistisi hyväksi Satu Jyväkorpi Ravitsemustieteilijä, ETM Tohtorikoulutettava, Helsingin yliopisto Gerontologinen ravitsemus Gery ry www.gery.fi Muistisairaiden määrä lisääntyy Muistisairauksiin sairastuu

Lisätiedot

30 RYHMÄ FARMASEUTTISET TUOTTEET

30 RYHMÄ FARMASEUTTISET TUOTTEET 30 RYHMÄ FARMASEUTTISET TUOTTEET Huomautuksia 1. Tähän ryhmään eivät kuulu: a) ravintovalmisteet ja juomat (kuten dieettiset, diabeettiset tai "vahvistetut" ravintovalmisteet, lisäravinteet, vahvistavat

Lisätiedot

Biokemian perusteet 26.9.2012: Hemoglobiini, Entsyymikatalyysi

Biokemian perusteet 26.9.2012: Hemoglobiini, Entsyymikatalyysi Biokemian perusteet 26.9.2012: Hemoglobiini, Entsyymikatalyysi Dos. Tuomas Haltia Sirppisoluanemia, Hb-mutaatio Glu-6 Val Hemoglobiini allosteerinen hapen kuljettajaproteiini (ei ole entsyymi!) Allosteerinen

Lisätiedot

Syövän lääkehoito. Salla Kalsi

Syövän lääkehoito. Salla Kalsi Syövän lääkehoito Salla Kalsi Syöpä Yleisnimitys maligneille (pahanlaatuisille) kasvaimille Karsinogeeninen = syöpää aiheuttava Syövän taustalla voi olla Ympäristötekijät, elintavat, perimä, eräät virus-

Lisätiedot

Miten geenitestin tulos muuttaa syövän hoitoa?

Miten geenitestin tulos muuttaa syövän hoitoa? ChemBio Helsingin Messukeskus 27.-29.05.2009 Miten geenitestin tulos muuttaa syövän hoitoa? Kristiina Aittomäki, dos. ylilääkäri HYKS Perinnöllisyyslääketieteen yksikkö Genomin tutkiminen FISH Sekvensointi

Lisätiedot

Komplementtitutkimukset

Komplementtitutkimukset Komplementtitutkimukset Hanna Jarva HUSLAB ja Haartman-instituutti Bakteriologian ja immunologian osasto Komplementti osa luontaista immuunijärjestelmää koostuu yli 30 proteiinista aktivoituu kaskadimaisesti

Lisätiedot

Kvantitatiivisen PCR:n käyttö mikrobivaurion toteamisessa

Kvantitatiivisen PCR:n käyttö mikrobivaurion toteamisessa Kvantitatiivisen PCR:n käyttö mikrobivaurion toteamisessa Maria Valkonen, Kaisa Jalkanen, Martin Täubel, Anne Hyvärinen 31.3.2014 Sisäilmastoseminaari 2014 1 Tausta Asumisterveysoppaan mukaiset sisäympäristön

Lisätiedot

Olen saanut tyypin 2 diabeteksen. Kysymyksiä ja vastauksia. Kysymyksiä ja mietteitä. Jos haluat saada lisätietoja, ota yhteyttä

Olen saanut tyypin 2 diabeteksen. Kysymyksiä ja vastauksia. Kysymyksiä ja mietteitä. Jos haluat saada lisätietoja, ota yhteyttä Kysymyksiä ja mietteitä Jos haluat saada lisätietoja, ota yhteyttä Sairaalaan/terveyskeskukseen puh: Diabetessairaanhoitajaan puh: Diabeteslääkäriin puh: Esite julkaistaan Bayer Health Care -yrityksen

Lisätiedot

PredictAD-hanke Kohti tehokkaampaa diagnostiikkaa Alzheimerin taudissa. Jyrki Lötjönen, johtava tutkija VTT

PredictAD-hanke Kohti tehokkaampaa diagnostiikkaa Alzheimerin taudissa. Jyrki Lötjönen, johtava tutkija VTT PredictAD-hanke Kohti tehokkaampaa diagnostiikkaa Alzheimerin taudissa Jyrki Lötjönen, johtava tutkija VTT 2 Alzheimerin taudin diagnostiikka Alzheimerin tauti on etenevä muistisairaus. Alzheimerin tauti

Lisätiedot

Labqualitypäivät 04.02.10 Riitta Karttunen. HUSLAB, kl. Mikrobiologia Virologian ja immunologian osasto

Labqualitypäivät 04.02.10 Riitta Karttunen. HUSLAB, kl. Mikrobiologia Virologian ja immunologian osasto Syfiliksen laboratoriodiagnostiikka ato od ag ost a Labqualitypäivät 04.02.10 Riitta Karttunen HUSLAB, kl. Mikrobiologia Virologian ja immunologian osasto Aiheet suora bakteerin osoitus tai nukleiinihappotestiosoitus

Lisätiedot

Käänteisestä rokotetutkimuksesta ratkaisu flavobakteeriongelmiin?

Käänteisestä rokotetutkimuksesta ratkaisu flavobakteeriongelmiin? Käänteisestä rokotetutkimuksesta ratkaisu flavobakteeriongelmiin? 26.3.2015 Kalaterveyspäivät, Tampere Krister Sundell Akvaattisen patobiologian laboratorio Åbo Akademi Flavobacterium psychrophilum Aiheuttaa

Lisätiedot

Kolme nappia päivässä. HELIX SLIM VOIMAA LUONNOSTA. Kolmella tabletilla päivässä pysyvään painonhallintaan.

Kolme nappia päivässä. HELIX SLIM VOIMAA LUONNOSTA. Kolmella tabletilla päivässä pysyvään painonhallintaan. Kolme nappia päivässä. HELIX SLIM VOIMAA LUONNOSTA Kolmella tabletilla päivässä pysyvään painonhallintaan. Kolmella tabletilla päivässä pysyvään painonhallintaan! Tärkeintä painonhallinnassa on tasapaino

Lisätiedot

Geenitekniikan perusmenetelmät

Geenitekniikan perusmenetelmät Loppukurssikoe To klo 14-16 2 osiota: monivalintatehtäväosio ja kirjallinen osio, jossa vastataan kahteen kysymykseen viidestä. Koe on auki klo 14.05-16. Voit tehdä sen oppitunnilla, jolloin saat tarvittaessa

Lisätiedot

tulehduksellisten suolistosairauksien yhteydessä

tulehduksellisten suolistosairauksien yhteydessä ADACOLUMN -HOITO tulehduksellisten suolistosairauksien yhteydessä www.adacolumn.net SISÄLTÖ Maha-suolikanava...4 Haavainen paksusuolitulehdus...6 Crohnin tauti...8 Elimistön puolustusjärjestelmä ja IBD...10

Lisätiedot

Ureakierron häiriöt ja rgaanishappovirtsaisuudet Lapsille

Ureakierron häiriöt ja rgaanishappovirtsaisuudet Lapsille Ureakierron häiriöt ja rgaanishappovirtsaisuudet Lapsille www.e-imd.org Mikä on ureakierron häiriö/orgaanishappovirtsaisuus? Kehomme hajottaa syömämme ruoan tuhansien kemiallisten reaktioiden avulla ja

Lisätiedot

Vitamiinit. Tärkeimpiä lähteitä: maksa, maitotuotteet, porkkana, parsakaali ja pinaatti

Vitamiinit. Tärkeimpiä lähteitä: maksa, maitotuotteet, porkkana, parsakaali ja pinaatti Vitamiinit A-vitamiini Tärkeimpiä lähteitä: maksa, maitotuotteet, porkkana, parsakaali ja pinaatti Välttämätön näköaistimuksen syntyyn hämärässä, solujen kasvuun ja erilaistumiseen sekä ihmisen lisääntymiseen.

Lisätiedot

BIOHIT OYJ. globaaleilla markkinoilla toimiva suomalainen bioteknologiayritys

BIOHIT OYJ. globaaleilla markkinoilla toimiva suomalainen bioteknologiayritys BIOHIT OYJ globaaleilla markkinoilla toimiva suomalainen bioteknologiayritys 1 Biohit lyhyesti Biohit Oyj on globaaleilla markkinoilla toimiva suomalainen bioteknologiayritys. Biohitin missio on "Innovating

Lisätiedot

HYVÄ RUOKA, PAREMPI MUISTI RAVITSEMUSASIANTUNTIJA, TTK SAARA LEINO 20.5.2014

HYVÄ RUOKA, PAREMPI MUISTI RAVITSEMUSASIANTUNTIJA, TTK SAARA LEINO 20.5.2014 HYVÄ RUOKA, PAREMPI MUISTI RAVITSEMUSASIANTUNTIJA, TTK SAARA LEINO 20.5.2014 TÄNÄÄN KESKUSTELLAAN: Muistisairauksien ehkäisyn merkitys Yleisimmät muistisairauden Suomessa ja niiden riskitekijät Mitkä ravitsemukselliset

Lisätiedot

Vastasyntyneiden aineenvaihduntaseula. 24.9.2015 Risto.Lapatto@Hus.Fi HY ja HYKS Lastenklinikka

Vastasyntyneiden aineenvaihduntaseula. 24.9.2015 Risto.Lapatto@Hus.Fi HY ja HYKS Lastenklinikka Vastasyntyneiden aineenvaihduntaseula 24.9.2015 Risto.Lapatto@Hus.Fi HY ja HYKS Lastenklinikka Esityksen tavoitteet Ymmärrät mistä tässä on kyse Seulontoja on erilaisia Näyte otetaan vauvasta Ketään ei

Lisätiedot

Kananmuna sisältää muun muassa D-vitamiina ja runsaasti proteiinia

Kananmuna sisältää muun muassa D-vitamiina ja runsaasti proteiinia Jogurtti luomuhillolla on parempi vaihtoehto kuin puuro tai aamumurot. Tutkijat ovat yhä enenevästi havainneet, mitä näiden viljojen gluteeni aiheuttaa terveydellemme. Gluteeni on syyllinen yli 150 eri

Lisätiedot

Näin elämme tänään kuinka voimme huomenna?

Näin elämme tänään kuinka voimme huomenna? Näin elämme tänään kuinka voimme huomenna? Yrittäjälääkäri Ville Pöntynen 22.1.2015 Lupauksen toiminta-ajatukset Hoidamme ja ennaltaehkäisemme sairauksia sekä työ- ja toimintakyvyn laskua lääketieteen,

Lisätiedot

Mahamysteeri. Mitkä ruoka-aineet sisältävät näitä aineita?

Mahamysteeri. Mitkä ruoka-aineet sisältävät näitä aineita? KOHDERYHMÄ: Työ voidaan tehdä yläkoulussa tai lukiossa. Teorian laajuus riippuu ryhmän tasosta/iästä. Parhaiten työ soveltuu yläkouluun kokonaisuuteen elollinen luonto ja yhteiskunta. KESTO: 1 h. MOTIVAATIO:

Lisätiedot

SUUN JA HAMPAIDEN HOITO

SUUN JA HAMPAIDEN HOITO Esitteitä 2008:8 ISSN 1236-2123 ISBN 978-952-00-2602-8 (PDF) Tämä esite on saatavilla verkosivuiltamme useilla kielillä. Sitä voi kopioida ja jakaa vapaasti. SUUN JA HAMPAIDEN HOITO Voit itse pitää huolta

Lisätiedot

VITAMIINEJA JA MINERAALEJA PULLOSTA

VITAMIINEJA JA MINERAALEJA PULLOSTA VITAMIINEJA JA MINERAALEJA PULLOSTA TAUSTA Vitamin Well on perustettu vuonna 2006 Ruotsissa. Tarkoituksena oli kehittää skandinaaviseen makuun sopiva vitamiinijuoma, joka samalla olisi hyvä ja moderni

Lisätiedot

Adacolumn -hoito tulehduksellisten suolistosairauksien yhteydessä

Adacolumn -hoito tulehduksellisten suolistosairauksien yhteydessä Adacolumn -hoito tulehduksellisten suolistosairauksien yhteydessä Hellävarainen vallankumous IBD-tautien hoidossa Sisältö Maha-suolikanava...4 Haavainen paksusuolitulehdus...6 Crohnin tauti...8 Elimistön

Lisätiedot

Immuunipuutokset. Olli Vainio OY Diagnostiikan laitos OYS Kliinisen mikrobiologian laboratorio 17.10.2008

Immuunipuutokset. Olli Vainio OY Diagnostiikan laitos OYS Kliinisen mikrobiologian laboratorio 17.10.2008 Immuunipuutokset Olli Vainio OY Diagnostiikan laitos OYS Kliinisen mikrobiologian laboratorio 17.10.2008 Immuunijärjestelm rjestelmän n toiminta Synnynnäinen immuniteetti (innate) Välitön n vaste (tunneissa)

Lisätiedot

Kohonnut verenpaine (verenpainetauti)

Kohonnut verenpaine (verenpainetauti) Kohonnut verenpaine (verenpainetauti) Lääkärikirja Duodecim Pertti Mustajoki, sisätautien erikoislääkäri Verenpaine on koholla, kun yläarvo on 140 tai ala-arvo yli 90 tai kumpikin luku on korkeampi. Kohonnut

Lisätiedot

Mind Master. Matti Vire 11.5.2013

Mind Master. Matti Vire 11.5.2013 Stressi = ympäristön yksilöön kohdistava uhka tai vahingollinen vaikutus sympaattinen hermojärjestelmä ja hypotalamus-aivolisäke-lisämunuainen aktivoituvat Akuutissa stressissä sydämen syke nousee, hengitys

Lisätiedot

Miten rokottaminen suojaa yksilöä ja rokotuskattavuus väestöä Merit Melin Rokotusohjelmayksikkö

Miten rokottaminen suojaa yksilöä ja rokotuskattavuus väestöä Merit Melin Rokotusohjelmayksikkö Miten rokottaminen suojaa yksilöä ja rokotuskattavuus väestöä Merit Melin Rokotusohjelmayksikkö 1 ESITYKSEN SISÄLTÖ Miten rokottaminen suojaa yksilöä? Immuunijärjestelmä Taudinaiheuttajilta suojaavan immuniteetin

Lisätiedot

Avainsanat: BI5 III Biotekniikan sovelluksia 9. Perimä ja terveys.

Avainsanat: BI5 III Biotekniikan sovelluksia 9. Perimä ja terveys. Avainsanat: mutaatio Monitekijäinen sairaus Kromosomisairaus Sukupuu Suomalainen tautiperintö Geeniterapia Suora geeninsiirto Epäsuora geeninsiirto Kantasolut Totipotentti Pluripotentti Multipotentti Kudospankki

Lisätiedot

TESTITULOSTEN YHTEENVETO

TESTITULOSTEN YHTEENVETO TESTITULOSTEN YHTEENVETO LIHASTEN VÄSYMINEN JA PALAUTUMINEN Lihaksesi eivät väsy niin helposti ja ne palautuvat nopeammin. Kehitettävä Hyvä AEROBINEN KUNTO Sinulla on edellytyksiä kasvattaa aerobista kuntoa

Lisätiedot

Urheilijan ravitsemus ja vastustuskyky - Valion tuotteet urheilijan ravitsemuksessa

Urheilijan ravitsemus ja vastustuskyky - Valion tuotteet urheilijan ravitsemuksessa Urheilijan ravitsemus ja vastustuskyky - Valion tuotteet urheilijan ravitsemuksessa Infektiot, allergiat ja astma urheilussa sairaudet ja vammat urheilussa UKK-instituutti 5.11.2012 Marika Laaksonen, ETT,

Lisätiedot

Vahva suolisto vahva vastustuskyky. Matti Vire 7.9.2013

Vahva suolisto vahva vastustuskyky. Matti Vire 7.9.2013 Ihmisen ruuansulatuksen muodostavat: Suu Mahalaukku Maksa (sappi) Haima Ohutsuoli Paksusuoli Peräsuoli Suun tehtävät: Pureskelu Syljen eritys Entsyymien eritys Mahalaukun tehtävät: Suolahapon eritys Pepsiinin

Lisätiedot

RAVITSEMUS MUISTISAIRAUKSIEN EHKÄISYSSÄ. Jan Verho Lailistettu ravitsemusterapeutti

RAVITSEMUS MUISTISAIRAUKSIEN EHKÄISYSSÄ. Jan Verho Lailistettu ravitsemusterapeutti RAVITSEMUS MUISTISAIRAUKSIEN EHKÄISYSSÄ Jan Verho Lailistettu ravitsemusterapeutti ELINTAPANEUVONTA EHKÄISEE MUISTIHÄIRIÖITÄ MUISTISAIRAUKSIEN EHKÄISY ALKAA JO KOHDUSSA Riittävä ravitsemus raskausaikana

Lisätiedot

Uuden vieritestin käyttöönotto avoterveydenhuollossa

Uuden vieritestin käyttöönotto avoterveydenhuollossa Uuden vieritestin käyttöönotto avoterveydenhuollossa HUSLAB Kliininen kemia ja hematologia 2009 kemisti Paula Pohja-Nylander Tavallisimmat vieritestit avoterveydenhuollossa Hemoglobiini Anemiadiagnostiikka

Lisätiedot

Ravitsemuksen ABC Energiaravintoaineet - proteiinin ja rasvan rooli

Ravitsemuksen ABC Energiaravintoaineet - proteiinin ja rasvan rooli Ravitsemuksen ABC Energiaravintoaineet - proteiinin ja rasvan rooli 8.11.2014 Kuopion Reippaan Voimistelijat Ry Ravitsemustieteen opiskelija Noora Mikkonen Aikataulu 25.10. Energiaravintoaineiden kirjo:

Lisätiedot

Käyttövesijärjestelmien tutkimus Sisäympäristö-ohjelmassa: laatu, turvallisuus sekä veden- ja energiansäästö

Käyttövesijärjestelmien tutkimus Sisäympäristö-ohjelmassa: laatu, turvallisuus sekä veden- ja energiansäästö VESI-INSTITUUTIN JULKAISUJA 5 Käyttövesijärjestelmien tutkimus Sisäympäristö-ohjelmassa: laatu, turvallisuus sekä veden- ja energiansäästö Aino Pelto-Huikko (toim.) Vesi-Instituutti WANDER Vesi-Instituutin

Lisätiedot

Naproxen Orion 25 mg/ml oraalisuspensio. 26.10.2015, Versio 1.2 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO

Naproxen Orion 25 mg/ml oraalisuspensio. 26.10.2015, Versio 1.2 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO Naproxen Orion 25 mg/ml oraalisuspensio 26.10.2015, Versio 1.2 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO VI.2 VI.2.1 Julkisen yhteenvedon osiot Tietoa sairauden esiintyvyydestä Naproxen Orion on

Lisätiedot

8 LEIPÄ JA VILJA RAVITSEMUKSESSA. Leipä ja vilja ravitsemuksessa (8)

8 LEIPÄ JA VILJA RAVITSEMUKSESSA. Leipä ja vilja ravitsemuksessa (8) 8 LEIPÄ JA VILJA RAVITSEMUKSESSA Leipä ja vilja ravitsemuksessa (8) Mitä leipä on? Kivennäisaineita Magnesiumia Rautaa Kaliumia Hivenaineita Sinkkiä Seleeniä Vettä Energiaa Hiilihydraatteja Proteiineja

Lisätiedot