Mitokondriosairauksissa aktivoituvia geenejä tunnistettu. Heikki Eräsalo Ohjaajat: FM Esko Kemppainen ja prof. Howard Jacobs BIOKEMIA

Koko: px
Aloita esitys sivulta:

Download "Mitokondriosairauksissa aktivoituvia geenejä tunnistettu. Heikki Eräsalo Ohjaajat: FM Esko Kemppainen ja prof. Howard Jacobs BIOKEMIA"

Transkriptio

1 Mitokondriosairauksissaaktivoituviageenejätunnistettu HeikkiEräsalo Ohjaajat:FMEskoKemppainenjaprof.HowardJacobs BIOKEMIA Mitokondrioperäiset sairaudet aiheuttavat laajan kirjon oireita ihmisillä. Oireisiin kuuluu esimerkiksi hermoston, aineenvaihdunnan häiriöt ja lihaskato sekä - heikkous. Tiedetään, että mitokondrioperäiset sairaudet aktivoivat suuren joukon geenejä, jotka auttavat potilasta selviämään. Tutkimuksessa tunnistettiin kolme geeniä jotka aktivoituivat mitokondriosairauden vuoksi ja saatiin uutta tietoa näiden geenien säätelymekanismeista. Lisäksi löydettiin useita solun sisäisestä viestinnästä vastaavaavia molekyylejä jotka ovat osallisena näiden geenien aktivoitumisessa.tämäantaauuttatietoamitokondriosairauksienmekanismeistaja rakentaapohjaatulevaisuudenhoitojenkehitykselle. Työssä hyödynnettiin banaanikärpäsmallia, jossa ilmenee samanlaiset oireet kuin ihmisilläkin ja mallisairauden taustamekanismi on sama kuin ihmisillä. Banaanikärpäsmallia hyödyntämällä voitiin suorittaa tutkimuksia, jotka ihmispotilaillaolisivatmahdottomiasuorittaa.tätämalliahyödyntämällälöydettiin geenejä, joiden vastineet löytyvät myös ihmisiltä ja jotka erittäin todennäköisesti aktivoituvat myös ihmisellä vastaavanlaisessa sairaustilassa. Tätä mallia hyödyntämällävoidaantulevaisuudessatuottaaentistäenemmäntietouttaihmisen sairauksistajamahdollisestilopultamyösparantaane. 1

2 Uudestadiagnostiikkalaitteestaapukehitysmaidenterveydenhuoltoon? RistoHanninen Ohjaajat:FMEtviJuntunen,TeppoSalminen,FTTeroSoukka,FTKimPettersson, DIDineshKumarjaFTNavinKhanna BIOTEKNIIKKADI Diplomityossa kehitettiin laitetta, joka soveltuu erityisesti kehitysmaiden diagnostiikkatarpeisiin. Laitteella luetaan lateraalivirtauslastuja, joissa on kaytetty leima-aineina upkonvertoivia loisteainepartikkeleita (UCP). Alustavat tulokset laitekehityksesta ovaat lupaavia, mutta prototyyppilaitten kehitys on viela kesken. Laitteella on tarkoitus pystya suorittamaan la hestulkoon mita tahansa diagnostiikkatestejakustannustehokkaasti. Laitteesta pyrittiin kehitta ma yksinkertainen, suorituskyvysta tinkima tta Yksinkertaisuus tuo huomattavia kustannussasto ja joka on tarkea erityisesti kehitysmaiden markkinoilla. Lateraalivirtauslastut mahdollistavat ma rityksen yksinkertaisen suorittamisen, UCP-partikkelit itse lukijalaitteen yksinkertaisen toiminnan. 2

3 Painolastivedenkäsittelyjärjestelmientestaamisessaonpuutteita? VilleKaataja Ohjaajat:DIMarkkuHelamaa,AuramarineOyjaFMMarkusVehniainen,Turun yliopisto,biotekniikka BIOTEKNIIKKADI Diplomityo tarkoituksena oli selvitta millaisia ongelmia painolastivedenka sittelyja rjestelmien testaamisessa saattaa esiintya Tuloksien perusteella painolastivedenkasittelyjarjestelma voivat toimia vaaditulla tavalla testiolosuhteissa, mutta eiva valttamatta niille tarkoitetussa meriymparisto ssa Vara positiivinen tulos saattaa johtaa painolastivedenkasittelyjarjestelmien alimitoittamiseen ja nain ollen tuhansien toimimattomien jarjestelmien asentamiseen. Painolastivetta kayteta laivojen tasapainottamiseen ja riittava uintisyvyyden saavuttamisen Painolastiveden mukana siirtyneet vieraselio ovat aiheuttaneet merkittavia ekologisia ja taloudellisia ongelmia jo vuosien ajan. Vuonna 2004 kansainva linen merenkulkujarjesto (IMO) hyvaksyi painolastivesia koskevan sopimuksen, jonka mukaan laivojen tulee puhdistaa painolastivetensa ennen sen purkuasatamiin.sopimuksenodotetaanastuvanvoimaanvuonna2013.seuraavan kymmenen vuoden aikana noin laivaa tulee varustaa painolastinpuhdistusjarjestelmilla Se merkitsee miljardien kokonaismarkkinoita puhdistusjarjestelmienvalmistajille. 3

4 Ihmisenvakavankehitysvammaisuudenaiheuttavaaproteiiniavoidaan tuottaakärpässoluissa HenriikkaKentala Ohjaajat:FTElisePintajaFTdos.PirkkoHeikinheimo BIOKEMIA Ihmisen vakavaan perinno lliseen kehitysvammaisuuteen liittyva CLN5-proteiinia tuotettiin karpassoluissa hetkellisessa tuottosolulinjassa, seka muodostamalla pysyva tuottosolulinja. Myo hemmin tutkittiin naiden kahden eri menetelma tehokkuutta proteiinituottoon. Tutkimuksessa selvisi, etta hetkellinen solulinja tuotti suuremman ma ra proteiinia solua kohti. Tulevaisuudessa on tarkoitus tuottaa ihmisen CLN5-proteiinia rakennetutkimuksiin, jonka avulla pyrita selvittama CLN5-proteiininnormaalitehtavasoluissa. CLN5-proteiinin perinno llisesta geenimutaatiosta seuraa ihmiselle vakava lapsuusia kehitysvammaisuus, joka kuuluu harvinaisiin lysosomaalisiin kertyma sairauksiin. Tautiin ei ole olemassa parantavaa lakehoitoa, minka vuoksi potilaat menehtyva noin kolmenkymmenen vuoden ikaisina CLN5-proteiinin normaalia tehtava soluissa ei tunneta, mutta sen tiedeta liittyva lysosomien toimintaan. Lysosomeja voidaan kuvailla solujen puhtaanapitolaitoksiksi, koska niidentehtava onhajottaasolunvanhojajaviallisiaosia.kunlysosomiteiva CLN5- geenin mutaation seurauksena toimi normaalisti, hajotettavaksi tarkoitettu materiaali kertyy ihmisessa mm. hermokudokseen, mika on syyna potilaiden kehitysvammaisuudenaiheuttavaanaivojenrappeutumiseen. Proteiinintehtavavoidaanyrittaselvittakolmiulotteisenrakenteenavulla,koska proteiinin toiminta perustuu usein sen oikeanlaiseen laskostumiseen. Rakenteen maritysta varten tarvitaan runsaasti puhdasta proteiinia ja siksi sita varten vaaditaan toimiva menetelma proteiinin tuottamiseksi. CLN5-proteiinin solunsisaisen tehtava selvittaminen toisi edistysaskeleen toimivien la kehoitojen kehitystyohon. Lisaksi se voisi edesauttaa muiden lysosomaalisten kertyma sairauksien profilointia, koska CLN5:n tiedeta vuorovaikuttavan solussa muidencln-proteiinienkanssa. 4

5 Coronaryarterydiseasediagnosticswithupconvertingnanoparticles(UCNPs) StevenKirkham Supervisors:M.Sc.RiikkaArppeandM.Sc.Marja-LeenaJärvenpää MOLECULARBIOTECHNOLOGYANDDIAGNOSTICS Upconvertingnanoparticles(UCNPs)arearound20-30nmindiameterandhave unique ability to radiate visible light when exposed to infrared (IR) light, called upconversion. Before the unique optical properties can be utilised in diagnostic assays, the surface of the nanoparticles needs to be activated. However, the small particle size creates problems in thesurface coating process as previous washing methods,suchascentrifugation,cannolongerbeusedduetothepooryieldofthe particles.thisworkhasfocuseduponoptimisingtheantibodycoatingoftheucnps andthenutilisingthesecoateducnpsaslabelsinanassayforsubstancefoundin human blood circulation during heart muscle damage, e.g. in coronary artery disease,cardiactroponin(ctni). Priortoantibodycoating,theUCNPsurfacewasactivatedtoenablewatersolubility and the ability of the particle to bind, e.g. to proteins. Thereafter, the anti-ctni antibodywasattachedto thesurface. Theantibody binding conditions,amountof antibody,andthewashingstepsofthereactionwereoptimisedtoimprovebinding capacityandyield.twofiltertubeswithdifferentfiltermembranes(300khadlarger pores,100ksmallerpores)andalsonewmagneticseparationmethodweretested. ctniassaywasthenusedtodetermineucnpsignalstrength,signaltobackground ratio,sensitivity,andnon-specificbinding. Thehighestyieldofantibody-coatedUCNPswasobtainedwiththe100kfilter (around100%).themagneticseparationmethodand300kfiltergavemuchlower yields(29%and21%,respectively).inthectniassay,allparticletypeshadsignal levelswhichincreasedasctniamountincreased.however,theydidn tworkwellat lower ctni concentrations. Thus further improvements such as more efficient blockingoftheparticlesurfaceandoptimisationofthebuffercontentsareneeded toincreaseucnpfunctionality. 5

6 Pikatestinkehittäminenvirtsanäytteillehengitystieinfektioiden diagnostiikkaan JuhaMattiKoskinen Ohjaaja:FTJanneO.Koskinen,ArcDiaInternationalOyLtd MOLEKULAARINENBIOTEKNIIKKAJADIAGNOSTIIKKA maripoc on infektiotautien osoittamiseen kehitetty taysin automatisoitu testijarjestelma jossa tunnistetaan useita taudinaiheuttajia samanaikaisesti ja nopeasti.tassaprogradu-tyo ssakehitettiinmaripoc -testijarjestelma pikatesti, jossahengitystieinfektiontaudinaiheuttajaosoitetaanvirtsanaytteesta. maripoc hyo dynta turkulaista koeputkitestauksen laser-teknologiaa. Myynnissa olevat testit on tarkoitettu hengitystieinfektioiden testaukseen nenanielusta tai nielusta otetusta nukkatikkunaytteesta Tyo tavoitteena oli tutkia uuden laserteknologian soveltuvuutta virtsanaytteiden pikatestaukseen seka kehitta legionellanjapneumokinvirtsastatunnistavattestit. Virtsasta todetun hengitystieinfektion taudinaiheuttajan oletetaan kertovan elimisto sisaisesta infektiosta ja olevan siten vahemma altis kantajuuden aiheuttamillekliinisestimerkityksettomilleloydo ksille.virtsanaytteenottaminenon yksinkertainentoimenpidetoisinkuinverinaytteenotto. Uusiamahdollisuuksiakeuhkokuumeendiagnostiikkaan Tulosten mukaan automatisoitu maripoc -pikatesti mahdollistaisi myo virtsanaytteidenlaboratoriotasoisenanalysoimisenkeuhkokuumepotilailtanopeasti ja tehokkaasti hoitopaikalla. Laser-teknologian todettiin kompensoivan muille testeille ongelmallisia ha irio tekijo ita Kompensoinnin ansiosta metodologian tarkkuusonkorkeaverrattunamarkkinajohtajanpikatestiin. 6

7 Kohtiluotettavampaadenguekuumediagnostiikkaa EricaKuusela Ohjaajat:Ph.D.GauravBatrajaFTUrpoLamminmaki MOLEKULAARINENBIOTEKNIIKKAJADIAGNOSTIIKKA Erikoistyo ssa valmistettiin geenifragmenttikirjasto, joka voi auttaa denguekuumediagnostiikan parantamista huomattavasti. Lisaksi tyo tulokset voivat edesauttaa rokotekehitysta Denguekuume on flaviviruksiin kuuluvan dengueviruksenaiheuttamatauti,jolleeitoistaiseksiolerokotettaeika diagnostiikkaa,joka antaisi luotettavan tuloksen. Nopea ja luotettava diagnostiikka on tarpeen tehokkaan hoidon mahdollistamiseksi. Ongelmana diagnostiikan kehityksessa on ollut denguevirustartunnan erottaminen muista flavivirustartunnoista, silla flavivirukset ja niiden aiheuttamat oireet ovat hyvin samanlaisia. Lisaksi denguevirustaonneljaalatyyppiajotkakaikkidiagnostiikanpitaisipystyatunnistamaan. Tyo tavoitteenaoliselvittamitka virusproteiinienosatalatyyppi1:nrakenteessa aiheuttavatihmisellaimmuunivasteen. Geenifragmenttikirjasto valmistettiin liittamalla dengueviruksen alatyyppi 1:n geenipalasia bakteeriviruksen genomiin. Na in saadaan tuotettua bakteeriviruksia, joiden pinnalle kyseiset geenipalat koodaavat erilaisia virusproteiinien osia. Geenifragmenttikirjasto sisalta miljoonia tallaisia bakteeriviruksia. Kirjastosta etsittiin alatyyppi 1:lle tyypillisia aminohappoketjuja, joihin dengue-virusta tunnistavat vasta-aineet sitoutuvat. Kaytetyt vasta-aineet olivat peraisin denguekuumepotilaan verinaytteesta Tulokset osoittivat, etta kirjaston valmistus onnistui, ja etta kirjasto toimii suunnitellusti. Tutkimukset verinaytteilla ovat kesken,muttaalustavattuloksetovatolleetlupaavia. 7

8 Viljattomanruokavalionvaikutuksestatyypindiabeteksessa LindaLauren Ohjaajat:FTRaineToivonenjaLTArnoHanninen BIOKEMIA Tutkimusryhmassamme on ennen todettu viljattoman ruokavalion vahentava tyypin diabeteksen (T1D) esiintyvyytta T1D:n hiirimallilla. Haima on suoraan yhteydessa ruuansulatuskanavaan, ja ruokavaliotekijo iden uskotaan vaikuttavan T1D:n syntyyn yhdessa suolistobakteerien kanssa. T1D:ssa elimisto puolustusjarjestelma tulehdussolut tuhoavat haimasaarekkeiden insuliinia tuottavat solut. Tyypin diabetes (T1D) on yleinen sairaus Suomessa ja sen esiintyvyysonlisa ntynytmaailmanlaajuisestivuosittain. Erikoistyo ssa kaytetylle hiirimallille kehittyy ihmisen tautia vastaava T1D. Hiiria ruokittiin viljattomalla erikoisruokavaliolla seka viljaa sisaltavalla perusruokavaliolla.seitsenviikkoisiltahiirilta kera ttiinhaima,ohutsuolenloppuosa ja paksusuoli. Haimansaarekkeet erotettiin muusta haimakudoksesta laserleikkaukseen perustuvalla menetelmalla Haimasaarekkeista seka ohut- ja paksusuolesta maritettiin tekijo ita jotka kertovat elinten tulehdusvasteesta ja vasteentulehdussoluistasekana idensatelysta. Myo erikoistyo tulokset viittaavat viljattoman ruokavalion T1D:lta suojaavaan vaikutukseen. Haimasaarekkeiden tulehdusvaste vaikuttaa viljattomalla ruokavaliolla vahentava tulehdusta perusruokavalioon verrattuna. Ohut- ja paksusuolentulehdusvasteetovatyhtenevajanayttavamolemmillaruokavalioilla tulehdusta va hentavilta Viljattoman ruokavalion tulehdusvaste on kuitenkin perusruokavaliota korkeampi, mika voi kertoa tama suojaavan tulehdukselta ja T1D:ltaperusruokavaliotaenemman. 8

9 Hampaankiinnityskudostentulehdustaaiheuttavabakteerisitookeskeistä tulehduksenvälittäjäainetta ElinaLohermaa Ohjaajat:FMAnnamariPainojaFTRiikkaIhalin BIOKEMIA Aggregatibacter actinomycetemcomitans-bakteeri aiheuttaa hampaan kiinnityskudosten tulehdusta (parodontiitti). Tutkimuksessa havaittiin, etta tallainen elinkykyinen bakteeri sitoo keskeista tulehduksenvalittajaainetta interleukiini (IL)-1ß:a. Lisaksi havaittiin, etta elinkykyisen bakteerin lasnaollessa ikenen solujen jakautuminen vahenee. Tutkimuksessa kaytettiin ienkudosta jaljitteleva kudosviljelymallia, joka koostui ihmisen ikenen soluista. Kudosviljelymalliaaltistettiinbakteerinmuodostamalleyhdyskunnalleelibiofilmille antibiootinkanssajailmanantibioottia. Biofilmitovatbakteerien muodostamia jarjestaytyneitayhteisoja jotkaaiheuttavat ihmisilla kroonisia tulehduksia vastustamalla isanna puolustusmekanismeja seka antibiootteja. Joidenkin biofilmeja muodostavien bakteerien on myo havaittu sitovantulehduksenvalittajaaineita.terveessahammastaympa ro ivassakudoksessa keskeinentulehduksenvalitta ja aineil-1ßedista solujenjakautumista. Sitomalla tulehduksenvalittajaainetta bakteeri saattaa heikenta ihmisen puolustusjarjestelma toimintaa paikallisesti seka mahdollisesti esta eraiden solujenjakautumista.na idenvuorovaikutustenosoittaminenvaatiivielatarkempia lisatutkimuksia. 9

10 Uudenmääritystekniikanhyödyntäminensydäninfarktindiagnostiikassa EevaMalmi Ohjaaja:FMHennaPakkila MOLEKULAARINENBIOTEKNIIKKAJADIAGNOSTIIKKA Sydaninfarktin aikana vaurioituneesta sydanlihaksesta vapautuu verenkiertoon useita normaalisti ainoastaan sydanlihaksessa esiintyvia proteiineja, joiden pitoisuutta voidaan tutkia verinaytteesta vaurion tunnistamiseksi. Yksi tallainen proteiini on sydanpera inen troponiini I, jonka havaitseminen veresta on selva merkkisydanlihaksen vaurioitumisesta. Tasta syystasen pitoisuuden mittaaminen verinaytteestaonkinnormaalitoimenpidesydaninfarktidiagnoosinvarmistamiseksi. Sydaninfarktin kuten monien muidenkin sairauksien diagnostiikassa testitulosten nopea saaminen saattaa olla potilaan kannalta elintarkea ja tasta syysta diagnostisiatestejapyritakehitta majatkuvastinopeammiksi.nopeudenlisaksi on tarkea etta marityksen herkkyys eli pienin havaittavissa oleva kohdemolekyylipitoisuus on riittava alhainen. Nopeiden ja samalla mahdollisimmanherkkienma ritystenkehittaminenonkuitenkinhaaste. Useissa diagnostisissa testeissa kohdemolekyylin havaitseminen perustuu leimaaineista mitattavaan valoon, jonka avulla voidaan tarkasti ma ritta tutkittavan kohdemolekyylin pitoisuus naytteessa Parempien leima-aineiden ja leimateknologioiden kehitys on yksi monista mahdollisuuksista saavuttaa marityksissaentista parempiherkkyysjanopeus. Tyo tavoitteena on osoittaa biotekniikan osastolla kehitetyn uudenlaisen leimateknologianluomatmahdollisuudetherkajanopeansydanperaistatroponiini I:ta tunnistavan marityksen kehittamiseksi. Onnistuessaan tyo edista diagnostiikan kehitysta ja mahdollistaa menetelma hyo dyntamisen myo muiden sairauksiendiagnostiikassa. 10

11 Vaihtoehtoisiamenetelmiäprobioottienelävyydenmäärittämiseen LeenaMattsson Ohjaajat:FTJuhaLappalainenjaFMMarkusVehniainen BIOTEKNIIKKADI Probiootit ovat eläviä mikro-organismeja, joilla on riittävässä määrin nautittuna terveydelle hyödyllisiä vaikutuksia. Probioottien elävyyttä arvioitiin adenosiinitrifosfaatin (ATP) määrään perustuen, laskemalla maljalla kasvavia pesäkkeitä, mikroskopoinnilla sekä värjäysmenetelmällä. ATP:n määrän mittauksella tulos saataisiin useita päiviä perinteistä maljausmenetelmää nopeammin. Myös jakaantumiskyvyttömät, mutta metabolisesti aktiiviset solut voidaan havaita ATP:n avulla. Tällaisilla soluilla saattaa olla samanlaisia probioottisiaterveysvaikutuksiakuinjakaantumiskykyisilläkinsoluilla. ATP:n mara perustuva mittaus sopi probiootin kasvun seuraamiseen liuosviljelyssa Kylma kuivatuille probiooteille ei standardisoitua menetelma onnistuttu kehittaman, silla havaittavan ATP:n mara vaihteli solujen kunnon, kannan, tuotantomenetelmien ja sailytyksen mukaan. Menetelmalla pystyta kuitenkinmahdollisestiseuraamaanyksittaisentuotteenaktiivisuudenvahenemista sa ilytyksenaikana. 11

12 c-flipproteiininfosforylaationvaikutust-auttajasolujenerilaistumiseen JohannaMyllyviita Ohjaajat:FMMinnaKyläniemijaprof.RiittaLahesmaa BIOKEMIA Erikoistyössä tutkittiin c-flip proteiinin lyhyen muodon (c-flips) fosforylaation vaikutusta T-auttajasolujen (Th-solujen) erilaistumiseen. Th-solut ovat tärkeä osa ihmisen immuunipuolustusta. Ne jakautuvat ainakin kahdeksi alaluokaksi: Th1- ja Th2-soluiksiriippuensolunkohtaamistasytokiineista.Myöskaspaasiaktiivisuudella on todettu olevan merkitys Th-solujen erilaistumisessa. Kaspaasi-8-proteiinin aktiivisuudenestämisenontodettulisäävänth2-solujentuottamanil4:nmäärääja Th2-solujen erilaistumista. Kaspaasiaktiivisuutta säätelevät monet tekijät mm. c- FLIP-proteiinineriisomuodot. c-flips:n stabiilisuutta sadella proteiinin fosforylaation avulla. Tyo ta varten proteiinistaon tehty kaksi mutaatiota,stabiloiva ja epastabiloiva, jotka kloonattiin plasmidiin. Plasmidit transfektoitiin periferaalisesta veresta eristettyihin T- auttajasoluihin. Solujen erilaistumista ja fosforyloinnin vaikutusta siihen tutkittiin erilaistenmenetelmienavulla. Erilaistumistatutkittiinkayttaenerilaistumismarkkereita,jotkaovatspesifisia joko Th1-taiTh2-soluille.Tutkimushypoteesinmukaanoletettiin,ettac-FLIPsproteiinin stabiloivamutaatioohjaasolujaenemmath2-suuntaankuinepastabiilimutaatio. Tama varmistamiseksitarvitaankuitenkinlisatutkimuksia. 12

13 Useanproteiinintutkiminensamastasyöpäkudosnäytteestä PetraMaki-Teeri Ohjaajat:FTTeijoPellinenjaFMRiina-MinnaVananen BIOTEKNIIKKADI Tyo ssakehitettiinmenetelma jonkaavullapystytatutkimaan useita proteiineja samanaikaisesti yhdesta syo pa kudosnaytteesta Tata menetelma voidaan kaytta hyo dyksi eri proteiinien vaikutussuhteiden tutkimisessa. Ta lla kahden erilaisen varjaysmenetelma ja multispektraalikuvantamisen yhdistelmalla saatiin selville, etta eturauhassyo pakudoksessa kahdella proteiinilla fosfo-akt:lla ja mieshormonireseptorillaonvaikutustoisiinsa. Aktiivisellamieshormonireseptorillaonmerkittava vaikutuseturauhassyo pasolujen kasvuun. Eturauhassyo pa hoidetaan estamalla mieshormonien sitoutuminen kohdereseptoriinsa, mutta tasta huolimatta joissakin tapauksissa syo pa uusiutuu. Toinen proteiini, fosfo-akt, on usein koholla naissa uusiutuneissa syovissa Tutkimuksen tarkoituksena oli tutkia mieshormonireseptorin ja fosfo-akt:n ilmentymistaeturauhassyo pakudoksissa. Tyo ssa kaytettiin kuvaustekniikkaa, jossa tutkittavasta kudosnaytteesta otetaan kuviauseallakymmenellavaloneriaallonpituudella. Ta ma antaapaljontarkempaa tietoa naytteen vareista verrattuna normaaliin varikuvaukseen, jossa kayteta kolmeaeriaallonpituusaluetta-punaista,vihrea jasinista(rgb).kunnaytteeneri komponenttien tarkat va rit tiedeta n, pystyta tietokoneohjelman avulla koko naytteesta erottelemaan naiden yksitta isten varien voimakkuudet. Eturauhassyo pakudoksessa olevat tutkittavat proteiinit varjattiin tavallisilla tai fluoresoivilla vareilla Tavallista varia havainnoidaan nakyva valon avulla, mutta fluoresoiva vari nahda vain UV-sateilyn avulla. Tama mahdollistaa useamman proteiinin tarkastelemisen samanaikaisesti, silla naiden kahden eri varjaysmenetelmavariteivasekoitutoisiinsa. 13

14 EPA:njaDPA:nsaantiravinnostamuidenomega-sarjanrasvahappojen rinnallaontärkeää AnuNuora Ohjaajat:FTKaisaLinderborgjaprof.HeikkiKallio ELINTARVIKEKEMIA Tutkimuksessa, jossa tutkittiin omega -sarjan rasvahappojen aterianja lkeisia vaikutuksiaihmisessasaatiinlisanaytto sille,ettaepa:njadpa:nsaantiravinnosta muiden omega -sarjan rasvahappojen rinnalla on tarkea Tutkimustulokset osoittavatettaravinnostasaatuepajadpanostavatepa:njadpa:nma ra aterian jalkeenyhdestaviiteentuntiin.pidemma aikavalintutkimuksiaihmisillakuitenkin tarvitaan, jotta nahda vaikuttavatko ravinnosta saadun EPA:n ja DPA:n mara positiivisestimyodha:nmaraihmisessaepa:n,dpa:njadha:nontodettu olevan edullisia ihmisen terveydelle. Niiden sanno llisen kayto on mm. todettu alentavankolesteroliajaparantavanmuistia. Perinteisesti EPA:n, DPA:n ja DHA:n aineenvaihduntaa ihmisessa on tutkittu sisa llyttama lla ateriohin kalao ljya tai hylkeen ljya Koska luonnon ljyt kuitenkin ovat rasvahappojen seoksia, on pelkasta ravinnosta saadun EPA:n tai DPA:n tai DHA:nvaikutustatoisiinsaollutvaikeatulkita.Myoskalyhyempienomega sarjanrasvahappojenmuuttumista pidemmiksi, kuten DHA:ksi, eiollavoitusulkea poistuloksista.tamaerikoistyotarkoituksenaolitutkiajaverrataepa:njadpa:n aterianjalkeista aineenvaihduntaa ihmisissa kun kaytossa oli puhdasta EPA:a ja puhdastadpa:tasisaltavatestiaamiaiset. Tutkimuksessa 10 vapaaehtoista koehenkilo so kukin kolme erilaista aamiaista. Kontrolliaamiainen,johonkahdestamuustaaamiaisestasaatujatuloksiaverrattiin, sisa lsi20oliivi ljya Kaksi muutaaamiaistasisalsiva18oliivi ljyajajoko EPA:ataiDPA:ta.Syo misenjalkeenkoehenkilo iltaotettiinverinaytteitatunninvalein yhdesta viiteen tuntiin. Veressa rasva kuljetetaan kylomikroneissa, jotka ovat oikeastaa veressa kulkevia rasvapisaroita. Na ma rasvapisarat eristettiin verinaytteistajaniidensisaltamarasvaanalysoitiintutkimuksessa. 14

15 Proteiininrakenneantaatietoasenstereospesifisyydestä PasiPaananen Ohjaajat:Ph.D.LailaNiiranenjaFTMikkoMetsa-Ketela BIOKEMIA Erikoistyo ssa selvitettiin landomysiinien reaktiotiehen liittyva entsyymi LanV:n atomitason rakenne rontgenkristallografian avulla. Tasta proteiinirakenteesta saatiin kolme erilaista mallia: proteiinin oman tuotteen 11-deoksilandomysinonin kanssa, tama kaltaisen rabelomysiinin kanssa, seka rakenne ilman naita Tama lisaksi kaikissa rakenteissa oli sitoutuneena entsyymin reaktioon osallistuva, siina kofaktorinatoimiva,nikotiiniamidiadeniinidinukleotidifosfaatti(nadp)-molekyyli. Landomysiinit kuuluvat angusykliineihin, bioaktiivisiin maaperabakteerien tuottamiin sekundaariaineenvaihdunnallisiin tuotteisiin. Angusykliineja ei toistaiseksi ole la kekayto ssa kuten joitain muita niiden kaltaisia molekyyleja Landomysiinien erikoispiirre on niiden 6-hiilen stereokemia, jonka muodostumisesta LanV vastaa. Proteiinirakenteista pystyttiin selvitta ma alue johon proteiinin muokkaama molekyyli sitoutuu, mitka proteiinin aminohapoista sitoutumiseen osallistuu, seka missa asennossa sen oma tuote ja ta ma kaltainen molekyyli sitoutuu alueeseen. Na ita tietoja voidaan kaytta pohjana suunnittelutyossa kun yriteta muokata entsyymin stereokemiaa uusien bioaktiivistenmolekyylientuottamiseksi. 15

16 Bakteerienhavainnointiverestäverenmyrkytyksessä MatleenaPunkkinen Ohjaajat:FMAriLehmusvuori,FMMariaNordin,FTPelleOhlssonja FTSaaraWittfooth BIOTEKNIIKKADI Kun taudin aiheuttavia bakteereita etsita veresta on tarkea etteiva veren ainesosat hairitse bakteerien havainnointia. Tutkimuksessa todettiin, etteiva tata aiheuttaneet veri, punasolut eika veriplasma tarpeeksi laimennettuina. Pienten solumarien saavuttamiseksi punasoluja voitiin poistaa bakteereja sisaltavasta verestailman,ettabakteeritkin poistuivat.ta matehtiin akustoforeesiksikutsutulla tekniikalla,jossapunasolujaohjattiinultraanenavulla. Yksisairauksista,jotkavoidaantunnistaaverestaloydettyjenmikrobienperusteella, onverenmyrkytyselisepsis.siinamikrobittunkeutuvatkehoonjaaiheuttavatkehon laajuisentulehduksen.verenmyrkytysonvakava,useinkuolemaanjohtavasairausja yksiyleisimmista sairaaloissa tapahtuvienkuolemiensyista Sentunnistaminen on vaikeaa,sillasenoireetmuistuttavatesimerkiksiinfluenssanoireita. Verenmyrkytyksenjasenaiheuttamanmikrobinnopeatunnistaminenonkuitenkin tarkeasillakuolemantodennako isyysnouseeverenmyrkytyksessahyvinnopeasti, ja laajakaytto isten antibioottien kayttaminen johtaa antibiooteille vastustuskykyisten bakteerien mara lisa ntymiseen. Tama takiatutkimuksessa autettiinkehittamanopeaabakteerientunnistusmenetelma verenmyrkytykseen. 16

17 Magneettejavoidaankäyttäänanopartikkelienerotteluun OskariSalovaara Ohjaajat:FTTerhiRiuttamäki,FMRiikkaArppejaprof.TeroSoukka BIOTEKNIIKKADI Diplomityossa kehitettiin magnetismiin perustuva erottelumenetelma joka mahdollistaa upkonvertoivien nanopartikkelien (lyh. UCNP) erottelun muista materiaaleista. Menetelma on nopeampi ja valikoivampi kuin perinteiset suodatukseenpohjautuvatsysteemit.erottelumenetelma perustuuhavaintoon,etta UCNP:t ovat magneettikentassa magnetisoituvia niiden sisaltamien lantanidien vuoksi. Lantanidit saavat aikaan UCNP-partikkelien ainutlaatuiset loisteominaisuudet, joiden takia ne ovat viime aikoina herattaneet suurta mielenkiintoadiagnostiikka-jabiokuvantamisaloilla. Magnetismiinperustuvaerottelumenetelma ottaamalliakaivosteollisuudesta,jossa vastaava menetelma on ollut kaytossa jo pitka eroteltaessa magneettisia malmipartikkeleita kaivoslietteesta Diplomityo ssa kehitetyssa menetelmassa neodyymikestomagneeteilla muodostettua magneettikentta saadaan vahvistettua magnetisoituvalla verkkomaisella rakenteella, joka koostuu yksinkertaisimmillaan esimerkiksi ruostumattomasta terasvillasta. Vahvistettu magneettikentta on niin voimakas,ettaseriittasitomaanucnp:ta,kunnejohdetaanverkkorakenteenlapi liuosmuodossa. Kun magneettikentta poistetaan, saadaan UCNP-partikkelit huuhdottuatalteenlaitteistosta. Jotta UCNP:ta voidaan hyo dynta diagnostiikkasovelluksissa, niiden pinta pita aktivoida useassa eri reaktiossa. Kussakin vaiheessa UCNP-liuokseen ja paljon ylima ra istamateriaalia,jokahairitseepartikkelienkaytto sovelluksissa.magneetti erottelumenetelma voidaan kaytta esimerkiksi eroteltaessa vasta-aineisiin kiinnitettyja UCNP:ta reaktioliuokseen ja neista vapaista vasta-aineista ja muista pinnoituskemikaaleista. Magneettikentta vaikuttaa vain UCNP-partikkeleihin ja kaikki ylima raiset ei-magneettiset pinnoituskemikaalit huuhtoutuvat pois erottelulaitteistosta.menetelma avulla voidaanmyokonsentroidanaytteita seka vaihtaa niita liuoksesta toiseen. Erottelukapasiteetin kasvattaminen vaatii viela lisatutkimuksia. 17

18 Entsyyminrakenteenvaikutusreaktionlopputuotteeseen LinneaSamila Ohjaajat:FTPauliKalliojaFTMikkoMetsa-Ketela BIOKEMIA Työssä tutkittiin AknH- ja SnoaL-entsyymeitä, jotka katalysoivat samankaltaisia reaktioitaantibioottiensynteesissä.työssätutkittiiinnäidenentsyymienrakenteen vaikutusta reaktion lopputuotteeseen vaihtamalla entsyymien osia keskenään. Tulokseksi saatiin, ettei yhden alueen vaihtaminen muuta lopputuotetta alkuperäisestä,vaantarvitaantodennäköisestikahdenalueenvaihto. Työssä tutkitut entsyymit osallistuvat luonnossa bakteerien tuottamien antibioottien tuotantoon. Tutkimalla näitä entsyymejä saadaan lisää tietoa niiden katalysoimista reaktioista ja miten niitä voitaisiin hyödyntää lääketeollisuuden käytössä.tulevaisuudessaonmahdollistasuunnitellauusiaantibioottejajatuottaa niitäuusillasuunnitelluillaentsyymeillä. 18

19 Lisäämahdollisuuksiasyövänkuvantamiseen HenriSipilä Ohjaajat:FMPauliinaLuoto,FTHarriTakalojaprof.AnneRoivainen BIOTEKNIIKKADI Tyo tarkoituksenaolikuvata puhdastilanjaanalyysimenetelmienvalidointi osana [ 68 Ga]-leimattujen radiolakkeiden tuotannon pystytysta Turun PET-keskuksessa. [ 68 Ga]radiolakeaineetovatuusiaSuomessajanetuovatlisamahdollisuuksiamuun muassa syova diagnostiikkaan. Tyo seurauksena saatujen tulosten perusteella puhdastilassa voitiin aloittaa kliiniseen kaytto tarkoitettujen [ 68 Ga]radiolakkeiden valmistaminen ja analyysimenetelma voitiin ottaa kaytto tuotannonlaadunvarmistuksessa. Positroniemissiotomografia(PET)onisotooppikuvantamisenmuoto, joka perustuu positronisateilijo iden kaytto merkkiaineena. Positroneja emittoiva radionuklidi liiteta biologisestiaktiiviseenyhdisteeseenkemiallisellasynteesilla Valmistuote, radiolakeaine, annostellaan potilaan verenkiertoon ja sen kulkeutumista elimistossa seurataan PET-kameralla. Kasvainten hoidossa PET-kuvasta saatavaa informaatiota voidaan kaytta apuna esimerkiksi kirurgisen operaation suunnittelussaseka hoidonseurannassa. 19

20 LateraalivirtausmääritysHIV-jahepatiitti-infektioidenhavaitsemiseen AnniSpangar Ohjaajat:FMEtviJuntunenjaprof.KimPettersson MOLEKULAARINENBIOTEKNIIKKAJADIAGNOSTIIKKA Erikoistyössä tutkittiin ja kehitettiin lateraalivirtaukseen perustuvaa määritystä HIV- ja hepatiitti B-infektioiden havaitsemiseen yhdestä näytteestä. Määrityksessä käytetytmerkkiaineetovathyvinerilaisia.hiv-määrityksessätunnistetaaninfektion aiheuttamaa immuunivastetta, eli virusta vastaan muodostuneita vasta-aineita. Hepatiitti -määrityksessä tunnistuskohteena puolestaan on hepatiitti - viruspartikkelinpinnallaesiintyväantigeeni. Lateraalivirtausmäärityksiä käytetään yleisesti pikatesteinä ja ne ovat helppokäyttöisiä ja edullisia, joten ne sopivat hyvin potilasläheiseen testaukseen esimerkiksikehittyvissämaissa.hepatiitti-virusjahi-virus(hiv)ovatveriteitse tarttuvia viruksia, jonka vuoksi on tärkeää seuloa esimerkiksi luovutettu veri infektioiden havaitsemiseksi. Onnistuneella monianalyyttimäärityksellä pystytään saamaan enemmän tietoa samasta näytteestä kuin yhtä analyyttia mittaavalla määrityksellä ilman, että määrityksen analyyttinen suorituskyky kärsii merkittävästi. 20

21 Edullisellaautomaatiollavauhtiatuotantoon ErnoSundberg Ohjaajat:FMTomPalenius,AbacusDiagnosticaOyjaFMAriLehmusvuori BIOTEKNIIKKADI GenomEra -testilastujen tuotantokapasiteetti on mahdollista kaksinkertaistaa edullisellaautomaatioratkaisulla. Automatisoinnillaonmahdollista saavuttaamyo merkittavia kustannussa sto ja GenomEra -testilastut ovat Abacus Diagnostica Oy:nDNA-pohjaisidiagnostisiatestejainfektiosairauksille. Tuotantoprosessinanalysoinnissahavaittiintuotannossaolevanpullonkauloja,jotka rajoittavat tuotantoa. Diplomityo ssa havaittiin pahimmaksi ongelmakohdaksi testilastujen merkitseminen. Tyo aikana selvitettiin erilaisia menetelmia testilastujenmerkitsemiseen.lupaavinvaihtoehtooliautomaattinenetiketo intilaite, joka kiinnitta isi etiketit automaattisesti jokaiseen testilastuun. Etiketo intilaitteella saavutettavat kustannussasto maksaisivat etiketo intilaitteen takaisin noin vuodessa. Diplomityo perusteella tuotannon laajamittaisella analysoinnilla, ja analysoinnin perusteella tehdylla kehitystyo lla pystyta tuotantokapasiteettia kasvattamaan merkittavastivarsinpienillakininvestoinneilla. 21

RUOANSULATUS JA SUOLISTON KUNTO. Iida Elomaa & Hanna-Kaisa Virtanen

RUOANSULATUS JA SUOLISTON KUNTO. Iida Elomaa & Hanna-Kaisa Virtanen RUOANSULATUS JA SUOLISTON KUNTO Iida Elomaa & Hanna-Kaisa Virtanen Edellisen leirin Kotitehtävä Tarkkaile sokerin käyttöäsi kolmen päivän ajalta ja merkkaa kaikki sokeria ja piilosokeria sisältävät ruuat

Lisätiedot

Autoimmuunitaudit: osa 1

Autoimmuunitaudit: osa 1 Autoimmuunitaudit: osa 1 Autoimmuunitaute tunnetaan yli 80. Ne ovat kroonisia sairauksia, joiden syntymekanismia eli patogeneesiä ei useimmissa tapauksissa ymmärretä. Tautien esiintyvyys vaihtelee maanosien,

Lisätiedot

Biologia. Pakolliset kurssit. 1. Eliömaailma (BI1)

Biologia. Pakolliset kurssit. 1. Eliömaailma (BI1) Biologia Pakolliset kurssit 1. Eliömaailma (BI1) tuntee elämän tunnusmerkit ja perusedellytykset sekä tietää, miten elämän ilmiöitä tutkitaan ymmärtää, mitä luonnon monimuotoisuus biosysteemien eri tasoilla

Lisätiedot

Sylvant (siltuksimabi) RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO

Sylvant (siltuksimabi) RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO EMA/198014/2014 Sylvant (siltuksimabi) RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO Tämä on Sylvant-valmistetta koskevan riskienhallintasuunnitelman yhteenveto, jossa esitetään toimenpiteet, joiden

Lisätiedot

K&V kasvattajaseminaari 16.10.2005 Marjukka Sarkanen

K&V kasvattajaseminaari 16.10.2005 Marjukka Sarkanen An update on the diagnosis of proteinuria in dogs Oct 1, 2003 By: Johanna Frank, DVM, Dipl. ACVIM PLN: Vioittuneet munuaiskeräset (glomerulus) laskevat veren proteiinin (albumiini) virtsaan. Syitä: glomerulonefriitti

Lisätiedot

NUORET TUTKIJAT 2012

NUORET TUTKIJAT 2012 NUORET TUTKIJAT 2012 Biokemia Elintarvikekemia Molekulaarinen biotekniikka ja diagnostiikka Biotekniikka DI NUORET TUTKIJAT 2012 Eräsalo Heikki Hänninen Risto Kaataja Ville Kentala Henriikka Kirkham Steven

Lisätiedot

Onko ruokavaliolla merkitystä reumasairauksien hoidossa?

Onko ruokavaliolla merkitystä reumasairauksien hoidossa? Onko ruokavaliolla merkitystä reumasairauksien hoidossa? Ravitsemusterapeutti Nea Kurvinen Ravitsemusterapia Balans nea.kurvinen@ravitsemusbalans.fi Ravitsemuksen merkitys reuman hoidossa Monipuolinen

Lisätiedot

Mistä tyypin 2 diabeteksessa on kyse?

Mistä tyypin 2 diabeteksessa on kyse? Mistä tyypin 2 diabeteksessa on kyse? Kenelle kehittyy tyypin 2 diabetes? Perimällä on iso osuus: jos lähisukulaisella on tyypin 2 diabetes, sairastumisriski on 50-70% Perinnöllinen taipumus vaikuttaa

Lisätiedot

C. difficile-diagnostiikan vaikutus epidemiologiaan, potilaan hoitoon ja eristyskäytäntöihin. Miksi lasten C. difficileä ei hoideta? 16.3.

C. difficile-diagnostiikan vaikutus epidemiologiaan, potilaan hoitoon ja eristyskäytäntöihin. Miksi lasten C. difficileä ei hoideta? 16.3. C. difficile-diagnostiikan vaikutus epidemiologiaan, potilaan hoitoon ja eristyskäytäntöihin. Miksi lasten C. difficileä ei hoideta? 16.3.2016 Eero Mattila HUS Infektioklinikka CDI = C. difficile infektio

Lisätiedot

Suolisto ja vastustuskyky. Lapin urheiluakatemia koonnut: Kristi Loukusa

Suolisto ja vastustuskyky. Lapin urheiluakatemia koonnut: Kristi Loukusa Suolisto ja vastustuskyky Lapin urheiluakatemia koonnut: Kristi Loukusa Suoliston vaikutus terveyteen Vatsa ja suolisto ovat terveyden kulmakiviä -> niiden hyvinvointi heijastuu sekä fyysiseen että psyykkiseen

Lisätiedot

Ravitsemus, terveys ja Suomen luonnosta saadut tuotteet. Raija Tahvonen

Ravitsemus, terveys ja Suomen luonnosta saadut tuotteet. Raija Tahvonen Ravitsemus, terveys ja Suomen luonnosta saadut tuotteet Raija Tahvonen Terveellinen ruokavalio on kasvivoittoinen Runsaasti: Kasviksia, marjoja ja hedelmiä Viljatuotteet pääosin täysjyväviljaa Kalaa ja

Lisätiedot

SUKLAA JA SYDÄNTERVEYS

SUKLAA JA SYDÄNTERVEYS SUKLAA JA SYDÄNTERVEYS terveystuote vai haitallinen herkku? Jaakko Mursu, TtM,, ravitsemusterapeutti Ravitsemusepidemiologian jatko opiskelija opiskelija Kansanterveyden tutkimuslaitos, Kuopion yliopisto

Lisätiedot

Liikunta. Terve 1 ja 2

Liikunta. Terve 1 ja 2 Liikunta Terve 1 ja 2 Käsiteparit: a) fyysinen aktiivisuus liikunta b) terveysliikunta kuntoliikunta c) Nestehukka-lämpöuupumus Fyysinen aktiivisuus: Kaikki liike, joka kasvattaa energiatarvetta lepotilaan

Lisätiedot

Läpimurto ms-taudin hoidossa?

Läpimurto ms-taudin hoidossa? Läpimurto ms-taudin hoidossa? Läpimurto ms-taudin hoidossa? Kansainvälisen tutkijaryhmän kliiniset kokeet uudella lääkkeellä antoivat lupaavia tuloksia sekä aaltoilevan- että ensisijaisesti etenevän ms-taudin

Lisätiedot

Jardiance-valmisteen (empagliflotsiini) riskienhallintasuunnitelman (RMP) yhteenveto

Jardiance-valmisteen (empagliflotsiini) riskienhallintasuunnitelman (RMP) yhteenveto EMA/188850/2014 Jardiance-valmisteen (empagliflotsiini) riskienhallintasuunnitelman (RMP) yhteenveto Tämä on Jardiance-valmisteen riskienhallintasuunnitelman yhteenveto, jossa esitetään toimenpiteet, joilla

Lisätiedot

UUSI LÄHESTYMISTAPA VARHAISEN ALZHEIMERIN TAUDIN RAVITSEMUSHOITOON POTILASOPAS

UUSI LÄHESTYMISTAPA VARHAISEN ALZHEIMERIN TAUDIN RAVITSEMUSHOITOON POTILASOPAS UUSI LÄHESTYMISTAPA VARHAISEN ALZHEIMERIN TAUDIN RAVITSEMUSHOITOON POTILASOPAS ALZHEIMERIN TAUDIN OIREET Alzheimerin taudin ensimmäinen oire on yleensä päivittäisten tapahtumien unohtuminen. Usein muistetaan

Lisätiedot

Komplementtitutkimukset

Komplementtitutkimukset Komplementtitutkimukset Hanna Jarva HUSLAB ja Haartman-instituutti Bakteriologian ja immunologian osasto Komplementti osa luontaista immuunijärjestelmää koostuu yli 30 proteiinista aktivoituu kaskadimaisesti

Lisätiedot

Viekirax-valmisteen (ombitasviiri/paritapreviiri/ritonaviiri) riskienhallintasuunnitelman yhteenveto

Viekirax-valmisteen (ombitasviiri/paritapreviiri/ritonaviiri) riskienhallintasuunnitelman yhteenveto EMA/775985/2014 Viekirax-valmisteen (ombitasviiri/paritapreviiri/ritonaviiri) enhallintasuunnitelman yhteenveto Tämä on Viekirax-valmisteen enhallintasuunnitelman yhteenveto, jossa esitetään toimenpiteet,

Lisätiedot

Jonne Seppälä. Lectio praecursoria

Jonne Seppälä. Lectio praecursoria Jonne Seppälä Lectio praecursoria 22.5.2015 Structural Studies on Filamin Domain Interactions Rakennetutkimuksia filamiini-proteiinin domeenivuorovaikutuksilla Mitä solu- ja molekyylibioginen tutkimus

Lisätiedot

Geneettisen tutkimustiedon

Geneettisen tutkimustiedon Geneettisen tutkimustiedon omistaminen Tutkijan näkökulma Katriina Aalto-Setälä Professori, sisätautien ja kardiologian erikoislääkäri Tampereen Yliopisto ja TAYS Sydänsairaala Etiikan päivät 9.3.2016

Lisätiedot

SELKÄYDINNESTEEN PERUSTUTKIMUKSET

SELKÄYDINNESTEEN PERUSTUTKIMUKSET Käyttöönottopäivä: 21.11.2011 1 (5) SELKÄYDINNESTEEN PERUSTUTKIMUKSET Atk-numero ja -lyhenne 1154 Li-BaktVi 1470 Li-Gluk 2186 Li-Laktaat 2514 Li-Prot 2655 Li-Solut 4059 Li-Syto Likvorin irtosolututkimus

Lisätiedot

Yläkouluakatemia viikot 6 ja 7 /2015

Yläkouluakatemia viikot 6 ja 7 /2015 Yläkouluakatemia viikot 6 ja 7 /2015 Suoliston vaikutus terveyteen Vatsa ja suolisto ovat terveyden kulmakiviä -> niiden hyvinvointi heijastuu sekä fyysiseen että psyykkiseen hyvinvointiin Jopa 80% ihmisen

Lisätiedot

Etunimi: Henkilötunnus:

Etunimi: Henkilötunnus: Kokonaispisteet: Lue oheinen artikkeli ja vastaa kysymyksiin 1-25. Huomaa, että artikkelista ei löydy suoraan vastausta kaikkiin kysymyksiin, vaan sinun tulee myös tuntea ja selittää tarkemmin artikkelissa

Lisätiedot

Urheilijan ravitsemus ja vastustuskyky - Valion tuotteet urheilijan ravitsemuksessa

Urheilijan ravitsemus ja vastustuskyky - Valion tuotteet urheilijan ravitsemuksessa Urheilijan ravitsemus ja vastustuskyky - Valion tuotteet urheilijan ravitsemuksessa Infektiot, allergiat ja astma urheilussa sairaudet ja vammat urheilussa UKK-instituutti 5.11.2012 Marika Laaksonen, ETT,

Lisätiedot

Nivelreuman serologiset testit: mitä ne kertovat? LT, apulaisylilääkäri Anna-Maija Haapala TAYS Laboratoriokeskus

Nivelreuman serologiset testit: mitä ne kertovat? LT, apulaisylilääkäri Anna-Maija Haapala TAYS Laboratoriokeskus Nivelreuman serologiset testit: mitä ne kertovat? LT, apulaisylilääkäri Anna-Maija Haapala TAYS Laboratoriokeskus Sisältö 1. Nivelreuma: etiologia, esiintyvyys, diagnostiikka 2. Nivelreuman serologiset

Lisätiedot

Paremman elämän puolesta

Paremman elämän puolesta Paremman elämän puolesta MSD toimii paremman elämän puolesta, suomalaisen potilaan parhaaksi. Meille on tärkeää, että jokainen lääkehoitoa tarvitseva saa juuri hänelle parhaiten sopivan hoidon. Me MSD:llä

Lisätiedot

Uuden vieritestin käyttöönotto avoterveydenhuollossa

Uuden vieritestin käyttöönotto avoterveydenhuollossa Uuden vieritestin käyttöönotto avoterveydenhuollossa HUSLAB Kliininen kemia ja hematologia 2009 kemisti Paula Pohja-Nylander Tavallisimmat vieritestit avoterveydenhuollossa Hemoglobiini Anemiadiagnostiikka

Lisätiedot

ASEA. Maailman ensimmäinen ja ainoa redoxsignalointimolekyyli valmiste. Mitä ovat redoxsignalointimolekyylit?

ASEA. Maailman ensimmäinen ja ainoa redoxsignalointimolekyyli valmiste. Mitä ovat redoxsignalointimolekyylit? ASEA Maailman ensimmäinen ja ainoa redoxsignalointimolekyyli valmiste Mitä ovat redoxsignalointimolekyylit? Kaikissa kehon soluissa on mitokondrioita, jotka ovat solujen voimanlähde. Mitokondriot erittävät

Lisätiedot

Kasvuteorian perusteista. Matti Estola 2013

Kasvuteorian perusteista. Matti Estola 2013 Kasvuteorian perusteista Matti Estola 2013 Solowin kasvumallin puutteet Solwin mallista puuttuu mikrotason selitys kasvulle, sillä mikrotasolla yritykset tekevät tuotantopäätökset kannattavuusperiaatteella

Lisätiedot

Cosentyx-valmisteen (sekukinumabi) riskienhallintasuunnitelman yhteenveto

Cosentyx-valmisteen (sekukinumabi) riskienhallintasuunnitelman yhteenveto EMA/775515/2014 Cosentyx-valmisteen (sekukinumabi) riskienhallintasuunnitelman yhteenveto Tämä on Cosentyx-valmisteen riskienhallintasuunnitelman yhteenveto, jossa esitetään toimenpiteet, joilla varmistetaan,

Lisätiedot

Biokemian perusteet 26.9.2012: Hemoglobiini, Entsyymikatalyysi

Biokemian perusteet 26.9.2012: Hemoglobiini, Entsyymikatalyysi Biokemian perusteet 26.9.2012: Hemoglobiini, Entsyymikatalyysi Dos. Tuomas Haltia Sirppisoluanemia, Hb-mutaatio Glu-6 Val Hemoglobiini allosteerinen hapen kuljettajaproteiini (ei ole entsyymi!) Allosteerinen

Lisätiedot

Alere i. Molecular. In minutes. PAINA TÄTÄ NIIN NÄET SEURAAVAN SIVUN

Alere i. Molecular. In minutes. PAINA TÄTÄ NIIN NÄET SEURAAVAN SIVUN Alere i Molecular. In minutes. PAINA TÄTÄ NIIN NÄET N SIVUN Alere i yhdistää nopeuden ja tarkkuuden hyödyt. Enää ei tarvitse tehdä kompromisseja potilaiden testauksessa ja kliinisessä päätöksenteossa.

Lisätiedot

Ulosteen veri Yleisimmät testit Suomessa

Ulosteen veri Yleisimmät testit Suomessa Ulosteen veri Yleisimmät testit Suomessa Actim Fecal Blood Medix Biochemica monoklonaaliset vasta-aineet HB:ta vastaan immunokromatografinen tikkutesti herkkyys 25-50µg hemoglobiinia/ gramma ulostetta

Lisätiedot

Immuunipuutokset. Olli Vainio OY Diagnostiikan laitos OYS Kliinisen mikrobiologian laboratorio 17.10.2008

Immuunipuutokset. Olli Vainio OY Diagnostiikan laitos OYS Kliinisen mikrobiologian laboratorio 17.10.2008 Immuunipuutokset Olli Vainio OY Diagnostiikan laitos OYS Kliinisen mikrobiologian laboratorio 17.10.2008 Immuunijärjestelm rjestelmän n toiminta Synnynnäinen immuniteetti (innate) Välitön n vaste (tunneissa)

Lisätiedot

Syövän lääkehoito. Salla Kalsi

Syövän lääkehoito. Salla Kalsi Syövän lääkehoito Salla Kalsi Syöpä Yleisnimitys maligneille (pahanlaatuisille) kasvaimille Karsinogeeninen = syöpää aiheuttava Syövän taustalla voi olla Ympäristötekijät, elintavat, perimä, eräät virus-

Lisätiedot

MIKROBIOLOGINEN VIERITESTIANALYTIIKKA. Yl Markku Koskela OYS / Mikrobiologian laboratorio (OML)

MIKROBIOLOGINEN VIERITESTIANALYTIIKKA. Yl Markku Koskela OYS / Mikrobiologian laboratorio (OML) MIKROBIOLOGINEN VIERITESTIANALYTIIKKA Yl Markku Koskela OYS / Mikrobiologian laboratorio (OML) MIKROBIOLOGINEN VIERITESTI Tutkimusmenetelmä, jolla: infektiotaudin laboratorio-diagnostiikka voidaan suorittaa

Lisätiedot

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan

Nimi sosiaaliturvatunnus. Vastaa lyhyesti, selkeällä käsialalla. Vain vastausruudun sisällä olevat tekstit, kuvat jne huomioidaan 1. a) Mitä tarkoitetaan biopolymeerilla? Mihin kolmeen ryhmään biopolymeerit voidaan jakaa? (1,5 p) Biopolymeerit ovat luonnossa esiintyviä / elävien solujen muodostamia polymeerejä / makromolekyylejä.

Lisätiedot

Naproxen Orion 25 mg/ml oraalisuspensio. 26.10.2015, Versio 1.2 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO

Naproxen Orion 25 mg/ml oraalisuspensio. 26.10.2015, Versio 1.2 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO Naproxen Orion 25 mg/ml oraalisuspensio 26.10.2015, Versio 1.2 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO VI.2 VI.2.1 Julkisen yhteenvedon osiot Tietoa sairauden esiintyvyydestä Naproxen Orion on

Lisätiedot

HERKKIEN TROPONIINIMÄÄRITYSTEN HÄIRIÖTEKIJÄT. Tanja Savukoski Biokemian laitos / Biotekniikka

HERKKIEN TROPONIINIMÄÄRITYSTEN HÄIRIÖTEKIJÄT. Tanja Savukoski Biokemian laitos / Biotekniikka HERKKIEN TROPONIINIMÄÄRITYSTEN HÄIRIÖTEKIJÄT Tanja Savukoski Biokemian laitos / Biotekniikka tanja.savukoski@utu.fi SISÄLTÖ Sydäninfarktin kriteerit Troponiinimääritykset Sydäninfarktispesifisyyden lasku

Lisätiedot

Adacolumn -hoito tulehduksellisten suolistosairauksien yhteydessä

Adacolumn -hoito tulehduksellisten suolistosairauksien yhteydessä Adacolumn -hoito tulehduksellisten suolistosairauksien yhteydessä Hellävarainen vallankumous IBD-tautien hoidossa Sisältö Maha-suolikanava...4 Haavainen paksusuolitulehdus...6 Crohnin tauti...8 Elimistön

Lisätiedot

Kotitehtävä. Ruokapäiväkirja kolmelta vuorokaudelta (normi reenipäivä, lepopäivä, kisapäivä) Huomioita, havaintoja?

Kotitehtävä. Ruokapäiväkirja kolmelta vuorokaudelta (normi reenipäivä, lepopäivä, kisapäivä) Huomioita, havaintoja? Kotitehtävä Ruokapäiväkirja kolmelta vuorokaudelta (normi reenipäivä, lepopäivä, kisapäivä) Huomioita, havaintoja? VÄLIPALA Tehtävä Sinun koulupäiväsi on venähtänyt pitkäksi etkä ehdi ennen illan harjoituksia

Lisätiedot

Liuenneen hiilen (CDOM) laatu menetelmän soveltaminen turv le. Jonna Kuha, Toni Roiha, Mika Nieminen,Hannu Marttila

Liuenneen hiilen (CDOM) laatu menetelmän soveltaminen turv le. Jonna Kuha, Toni Roiha, Mika Nieminen,Hannu Marttila Liuenneen hiilen (CDOM) laatu menetelmän soveltaminen turvemaille Jonna Kuha, Toni Roiha, Mika Nieminen,Hannu Marttila Mitä humusaineet ovat? Liuenneen eloperäisen (orgaanisen) aineksen eli humuksen värillinen

Lisätiedot

Potilaan opas. Tietoa henkilöille, joille on määrätty botulinutoksiini B:tä (NeuroBloc ) servikaalisen dystonian hoitoon

Potilaan opas. Tietoa henkilöille, joille on määrätty botulinutoksiini B:tä (NeuroBloc ) servikaalisen dystonian hoitoon Potilaan opas Tietoa henkilöille, joille on määrätty botulinutoksiini B:tä (NeuroBloc ) servikaalisen dystonian hoitoon Oppaan on laatinut Eisai Europe Limited Tässä oppaassa kerrotaan NeuroBloc -lääkkeestä

Lisätiedot

VAASAN YLIOPISTO TEKNILLINEN TIEDEKUNTA SÄHKÖTEKNIIKKA. Lauri Karppi j82095. SATE.2010 Dynaaminen kenttäteoria DIPOLIRYHMÄANTENNI.

VAASAN YLIOPISTO TEKNILLINEN TIEDEKUNTA SÄHKÖTEKNIIKKA. Lauri Karppi j82095. SATE.2010 Dynaaminen kenttäteoria DIPOLIRYHMÄANTENNI. VAASAN YLIOPISTO TEKNILLINEN TIEDEKUNTA SÄHKÖTEKNIIKKA Oskari Uitto i78966 Lauri Karppi j82095 SATE.2010 Dynaaminen kenttäteoria DIPOLIRYHMÄANTENNI Sivumäärä: 14 Jätetty tarkastettavaksi: 25.02.2008 Työn

Lisätiedot

santasport.fi URHEILIJAN RAVINTO Yläkouluakatemialeiri vko 32 2015 Santasport Lapin Urheiluopisto I Hiihtomajantie 2 I 96400 ROVANIEMI

santasport.fi URHEILIJAN RAVINTO Yläkouluakatemialeiri vko 32 2015 Santasport Lapin Urheiluopisto I Hiihtomajantie 2 I 96400 ROVANIEMI santasport.fi URHEILIJAN RAVINTO Yläkouluakatemialeiri vko 32 2015 Santasport Lapin Urheiluopisto I Hiihtomajantie 2 I 96400 ROVANIEMI 2 11.8.2015 PALAUTUMINEN -kehittymisen kulmakivi - Harjoittelun tarkoitus

Lisätiedot

Sideaineen talteenoton, haihdutuksen ja tunkeuma-arvon tutkiminen vanhasta päällysteestä. SFS-EN 12697-3

Sideaineen talteenoton, haihdutuksen ja tunkeuma-arvon tutkiminen vanhasta päällysteestä. SFS-EN 12697-3 Sideaineen talteenoton, haihdutuksen ja tunkeuma-arvon tutkiminen vanhasta päällysteestä. SFS-EN 12697-3 1 Johdanto Tutkimus käsittelee testausmenetelmästandardin SFS-EN 12697-3 Bitumin talteenotto, haihdutusmenetelmää.

Lisätiedot

LIHAKARJAN RUOKINTAOPAS

LIHAKARJAN RUOKINTAOPAS V a s i k a s t a p i h v i k s i LIHAKARJAN RUOKINTAOPAS TEHOKKAAT REHUT, TERVEET ELÄIMET. Rehuraisio Tehokas ruokinta parantaa kannattavuutta Tehokas ruokinta lyhentää lihanaudan kasvatusaikaa ja eläimet

Lisätiedot

Avainsanat: BI5 III Biotekniikan sovelluksia 9. Perimä ja terveys.

Avainsanat: BI5 III Biotekniikan sovelluksia 9. Perimä ja terveys. Avainsanat: mutaatio Monitekijäinen sairaus Kromosomisairaus Sukupuu Suomalainen tautiperintö Geeniterapia Suora geeninsiirto Epäsuora geeninsiirto Kantasolut Totipotentti Pluripotentti Multipotentti Kudospankki

Lisätiedot

1.000.000.000.000 euron ongelma yksi ratkaisu Suomesta? Sijoitus Invest 2015, Helsinki 11.11.2015 Pekka Simula, toimitusjohtaja, Herantis Pharma Oyj

1.000.000.000.000 euron ongelma yksi ratkaisu Suomesta? Sijoitus Invest 2015, Helsinki 11.11.2015 Pekka Simula, toimitusjohtaja, Herantis Pharma Oyj 1.000.000.000.000 euron ongelma yksi ratkaisu Suomesta? Sijoitus Invest 2015, Helsinki 11.11.2015 Pekka Simula, toimitusjohtaja, Herantis Pharma Oyj 1 Tärkeää tietoa Herantis Pharma Oy ( Yhtiö ) on laatinut

Lisätiedot

Käyttövesijärjestelmien tutkimus Sisäympäristö-ohjelmassa: laatu, turvallisuus sekä veden- ja energiansäästö

Käyttövesijärjestelmien tutkimus Sisäympäristö-ohjelmassa: laatu, turvallisuus sekä veden- ja energiansäästö VESI-INSTITUUTIN JULKAISUJA 5 Käyttövesijärjestelmien tutkimus Sisäympäristö-ohjelmassa: laatu, turvallisuus sekä veden- ja energiansäästö Aino Pelto-Huikko (toim.) Vesi-Instituutti WANDER Vesi-Instituutin

Lisätiedot

Näiden aihekokonaisuuksien opetussuunnitelmat ovat luvussa 8.

Näiden aihekokonaisuuksien opetussuunnitelmat ovat luvussa 8. 9. 11. b Oppiaineen opetussuunnitelmaan on merkitty oppiaineen opiskelun yhteydessä toteutuva aihekokonaisuuksien ( = AK) käsittely seuraavin lyhentein: AK 1 = Ihmisenä kasvaminen AK 2 = Kulttuuri-identiteetti

Lisätiedot

URHEILIJAN RAVINTO. Ateriarytmi, Urheilijan lautasmalli. Yläkouluakatemia Vko 31. santasport.fi

URHEILIJAN RAVINTO. Ateriarytmi, Urheilijan lautasmalli. Yläkouluakatemia Vko 31. santasport.fi santasport.fi URHEILIJAN RAVINTO Ateriarytmi, Urheilijan lautasmalli Yläkouluakatemia 2016-2017 Vko 31 Santasport Lapin Urheiluopisto I Hiihtomajantie 2 I 96400 ROVANIEMI Ravintovalmennuksen tavoitteet

Lisätiedot

HPV-rokote tulee rokotusohjelmaan mitä, kenelle, miksi?

HPV-rokote tulee rokotusohjelmaan mitä, kenelle, miksi? HPV-rokote tulee rokotusohjelmaan mitä, kenelle, miksi? Tuija Leino THL Kerron tässä alkavasta rokotusohjelmasta rokotteesta Miksi otettu ohjelmaan? Miltä taudilta suojaudutaan? Miksi otettu ohjelmaan

Lisätiedot

Kipupotilas psykiatrin vastaanotolla. Ulla Saxén Ylilääkäri Satshp, yleissairaalapsykiatrian yksikkö 26.05.2016

Kipupotilas psykiatrin vastaanotolla. Ulla Saxén Ylilääkäri Satshp, yleissairaalapsykiatrian yksikkö 26.05.2016 Kipupotilas psykiatrin vastaanotolla Ulla Saxén Ylilääkäri Satshp, yleissairaalapsykiatrian yksikkö 26.05.2016 ICD-10 tautiluokituksessa kipuoire esiintyy vain muutaman psykiatrisen diagnoosin kuvauksessa

Lisätiedot

Innovaatioaamupäivä 18.3.2016

Innovaatioaamupäivä 18.3.2016 Innovaatioaamupäivä 18.3.2016 Kauran tuotteistaminen Tuula Laukkanen 1 18/3/16 Fazer. All rights reserved Fazer Mylly osa Fazer konsernia Fazerin tarina alkoi vuonna 1891 Karl Fazerin avattua ensimmäisen

Lisätiedot

BIOLOGIAN KYSYMYKSET

BIOLOGIAN KYSYMYKSET BIOLOGIAN KYSYMYKSET Biologian osakokeessa on 10 kysymystä. Tarkista, että saamassasi vastausmonisteessa on sivut 1-10 numerojärjestyksessä. Tarkastajien merkintöjä varten 1 2 3 4 5 6 7 8 9 10 max 80p

Lisätiedot

CORTIMENT (budesonidi) 26.11.2013, versio 1.0 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO

CORTIMENT (budesonidi) 26.11.2013, versio 1.0 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO CORTIMENT (budesonidi) 26.11.2013, versio 1.0 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO VI.2 Julkisen yhteenvedon osiot VI.2.1 Tietoa sairauden esiintyvyydestä Haavainen paksusuolentulehdus (UC)

Lisätiedot

RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO

RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO Noviana 0,5 mg/0,1 mg kalvopäällysteiset tabletit 19.5.2014, Painos 3, versio 1.0 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO VI.2 Julkisen yhteenvedon osiot VI.2.1 Tietoa sairauden esiintyvyydestä

Lisätiedot

Pohjajarven vuosilustoisten sedimenttien paleomagneettinen tutkimus: Paleosekulaarivaihtelu Suomessa viimeisten 3200 vuoden aikana

Pohjajarven vuosilustoisten sedimenttien paleomagneettinen tutkimus: Paleosekulaarivaihtelu Suomessa viimeisten 3200 vuoden aikana Raportti Q29.119612 Timo J. Saarinen Geofysiikan osasto Gtk Pohjajarven vuosilustoisten sedimenttien paleomagneettinen tutkimus: Paleosekulaarivaihtelu Suomessa viimeisten 3200 vuoden aikana Paleomagnetic

Lisätiedot

BIOLÄÄKETIETEEN LÄPIMURROT

BIOLÄÄKETIETEEN LÄPIMURROT BIOLÄÄKETIETEEN LÄPIMURROT Jussi Huttunen Tampere 20.4.2016 LÄÄKETIETEEN MEGATRENDIT Väestö vanhenee ja sairauskirjo muuttuu Teknologia kehittyy - HOITOTEKNOLOGIA - tietoteknologia Hoito yksilöllistyy

Lisätiedot

Diagnostisten testien arviointi

Diagnostisten testien arviointi Erkki Savilahti Diagnostisten testien arviointi Koe antaa tuloksen pos/neg Laboratoriokokeissa harvoin suoraan luokiteltavissa Testin hyvyys laskettavissa tunnuslukujen avulla Diagnostisten testien arviointi

Lisätiedot

Terra - täysin uusi sarja pieneläimille

Terra - täysin uusi sarja pieneläimille Terra - täysin uusi sarja pieneläimille Terra sisältää parhaat luonnon raaka-aineet kunnioittaen eläimen luonnollisia syömistapoja. Terra täyttää eläimen ruokinnalliset tarpeet. KOOSTUMUS: Kasvisperäiset

Lisätiedot

RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO

RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO Numeta G16E, Numeta G19E 2332015, Versio 30 RISKIENHALLINTASUUNNITELMAN JULKINEN YHTEENVETO VI2 Julkisen yhteenvedon osiot VI21 Tietoa sairauden esiintyvyydestä Joillakin sairaalapotilailla ei välttämättä

Lisätiedot

Nekroottinen enteriitti kalkkunoilla

Nekroottinen enteriitti kalkkunoilla Nekroottinen enteriitti kalkkunoilla Päivikki Perko-Mäkelä Erikoistutkija, ELT Evira, Seinäjoki Kuva: Sirkka Karikko Nekroottinen enteriitti Nekroottinen enteriitti on Clostridium perfringens bakteerin

Lisätiedot

Miten rokottaminen suojaa yksilöä ja rokotuskattavuus väestöä Merit Melin Rokotusohjelmayksikkö

Miten rokottaminen suojaa yksilöä ja rokotuskattavuus väestöä Merit Melin Rokotusohjelmayksikkö Miten rokottaminen suojaa yksilöä ja rokotuskattavuus väestöä Merit Melin Rokotusohjelmayksikkö 1 ESITYKSEN SISÄLTÖ Miten rokottaminen suojaa yksilöä? Immuunijärjestelmä Taudinaiheuttajilta suojaavan immuniteetin

Lisätiedot

HYVIÄ NEUVOJA, JOIDEN AVULLA. voit saada diabeteksesi hallintaan

HYVIÄ NEUVOJA, JOIDEN AVULLA. voit saada diabeteksesi hallintaan OLE AKTIIVINEN HYVIÄ NEUVOJA, JOIDEN AVULLA voit saada diabeteksesi hallintaan Omat arvoni Päivämäärä / / / / / / / / / / / / HbA 1c (mmol/mol, %) LDL-kolesteroli (mmol/l) Verenpaine (mmhg) Paino (kg)

Lisätiedot

Virtsan kemiallisen seulonnan kliininen käyttö. Dosentti Martti L.T. Lalla Osastonylilääkäri HUSLAB Kirurginen sairaala 4.2.2009

Virtsan kemiallisen seulonnan kliininen käyttö. Dosentti Martti L.T. Lalla Osastonylilääkäri HUSLAB Kirurginen sairaala 4.2.2009 Virtsan kemiallisen seulonnan kliininen käyttö Dosentti Martti L.T. Lalla Osastonylilääkäri HUSLAB Kirurginen sairaala Virtsa elimistön tietolähteenä Virtsa - ensimmäinen kehon aine, jonka tutkiminen yhdistettiin

Lisätiedot

Kiintoainemenetelmien käyttö turvemaiden alapuolella. Hannu Marttila

Kiintoainemenetelmien käyttö turvemaiden alapuolella. Hannu Marttila Kiintoainemenetelmien käyttö turvemaiden alapuolella Hannu Marttila Motivaatio Orgaaninen kiintoaines ja sedimentti Lisääntynyt kulkeutuminen johtuen maankäytöstä. Ongelmallinen etenkin turvemailla, missä

Lisätiedot

TUTKIMUSRAPORTTI Luokat 202, 207 ja 208

TUTKIMUSRAPORTTI Luokat 202, 207 ja 208 TUTKIMUSRAPORTTI Luokat 202, 207 ja 208 Kotkan lyseo, Arcus-talo Kirkkokatu 15 48100 KOTKA Työ nro T8007-5 Kotka 5.4.2016 Oy Insinööri Studio OY INSINÖÖRI STUDIO, TORNATORINTIE 3, PL 25, 48101 KOTKA, PUH.

Lisätiedot

Geenimonistus -ongelmia

Geenimonistus -ongelmia Geenimonistus -etuja nopeus spesifisyys herkkyys ei tarvitse elävää virusta tunnistetaan viruksia, joita ei voida viljellä hitaasti kasvavien virusten tunnistus nopeutuu kvantitaatio, genotyypitys Geenimonistus

Lisätiedot

Trulicity-valmisteen (dulaglutidi) riskienhallintasuunnitelman (RMP) yhteenveto

Trulicity-valmisteen (dulaglutidi) riskienhallintasuunnitelman (RMP) yhteenveto EMA/601943/2014 Trulicity-valmisteen (dulaglutidi) riskienhallintasuunnitelman (RMP) yhteenveto Tämä on Trulicity-valmisteen riskienhallintasuunnitelman (RMP) yhteenveto, jossa esitetään toimenpiteet,

Lisätiedot

Tietojärjestelmien tuottamien hälytysten käyttö infektiopotilaiden hoitopäätöksissä

Tietojärjestelmien tuottamien hälytysten käyttö infektiopotilaiden hoitopäätöksissä Tietojärjestelmien tuottamien hälytysten käyttö infektiopotilaiden hoitopäätöksissä Infektiolääkäri Sakari Vuorinen Terveydenhuollon ATK-päivät 30.05.2006 klo 10-10.30 Terveydenhuollossa 3 erilaista infektioista

Lisätiedot

Kuva 1. Korento lehdellä (Miettinen, A., 2006).

Kuva 1. Korento lehdellä (Miettinen, A., 2006). Pigmentit yönteisten värien monimuotoisuus (ks. kuva 1) on aina kiehtonut luonnontieteilijöitä. Vasta 1900-luvun alussa alettiin ymmärtää pigmenttien kemiaa. Pigmentit esiintyvät luonnon materiaaleissa

Lisätiedot

Betoni&Muovimatto&Kosteus asiantuntijaseminaari ja työpaja Sekundaariset Päästöt ja mittaus

Betoni&Muovimatto&Kosteus asiantuntijaseminaari ja työpaja Sekundaariset Päästöt ja mittaus Betoni&Muovimatto&Kosteus asiantuntijaseminaari ja työpaja Sekundaariset Päästöt ja mittaus 06.06.2016 Vesa Räsänen Hassan Raad Gunnar Laurén Kokonaisemissiot Vaikka yksittäinen rakennusmateriaali on luokiteltu

Lisätiedot

Keramidit, sydänkohtausriskitesti, CERT

Keramidit, sydänkohtausriskitesti, CERT Keramidit, sydänkohtausriskitesti, CERT VAIKUTTAVAA TERVEYSPALVELUA Keramidit, sydänkohtausriskitesti, CERT Coronary Event Risk Test eli CERT on uusi tutkimus, jonka avulla voidaan arvioida henkilön sydäninfarktiriskiä.

Lisätiedot

Sanna Nikunen ELL 4.10.2012

Sanna Nikunen ELL 4.10.2012 Sanna Nikunen ELL 4.10.2012 Kuuluu heimoon Orthomyxoviridae, joka jaetaan kahteen sukuun; Influenssa A- ja B- virukset sekä influenssa C-virukset A-virukset eläimillä ja ihmisillä, B- virukset harvinaisempia,

Lisätiedot

DNA RNA proteiinit transkriptio prosessointi translaatio regulaatio

DNA RNA proteiinit transkriptio prosessointi translaatio regulaatio CELL 411-- replikaatio repair mitoosi meioosi fertilisaatio rekombinaatio repair mendelistinen genetiikka DNA-huusholli Geenien toiminta molekyyligenetiikka DNA RNA proteiinit transkriptio prosessointi

Lisätiedot

Virologiset pika- ja vieritestit

Virologiset pika- ja vieritestit Virologiset pika- ja vieritestit HUSLAB - VIROLOGIA POC-testien käyttäjiä Itsehoito koti Terveysasemat Doctor s Office Ensiapupoliklinikka Teho-osasto leikkaussali Laboratorio Virologian pikatestejä Hepatiitti

Lisätiedot

High Definition Body Lift selluliittigeeli

High Definition Body Lift selluliittigeeli High Definition Body Lift selluliittigeeli Lehdistötiedote helmikuu 2009 Paras tapa huolehtia vartalon virtaviivaisesta ulkonäöstä on syödä terveellisesti ja liikkua säännöllisesti. Liikunta ja runsaasti

Lisätiedot

VAPAAEHTOISILLA TEHTY TESTIMITTAUS HARMONIFIN TM SUOJAAVIEN VAIKUTUKSIEN SELVITTÄMISEKSI SÄHKÖMAGNEETTISEN KENTÄN MILLIMETRIN AALLONPITUUSALUEELLA

VAPAAEHTOISILLA TEHTY TESTIMITTAUS HARMONIFIN TM SUOJAAVIEN VAIKUTUKSIEN SELVITTÄMISEKSI SÄHKÖMAGNEETTISEN KENTÄN MILLIMETRIN AALLONPITUUSALUEELLA VAPAAEHTOISILLA TEHTY TESTIMITTAUS HARMONIFIN TM SUOJAAVIEN VAIKUTUKSIEN SELVITTÄMISEKSI SÄHKÖMAGNEETTISEN KENTÄN MILLIMETRIN AALLONPITUUSALUEELLA ELIMISTÖSI HARMONIASSA Email: info@nanosmart.fi Web: www.nanosmart.fi

Lisätiedot

Miten genomitieto on muuttanut ja tulee muuttamaan erikoissairaanhoidon käytäntöjä

Miten genomitieto on muuttanut ja tulee muuttamaan erikoissairaanhoidon käytäntöjä Miten genomitieto on muuttanut ja tulee muuttamaan erikoissairaanhoidon käytäntöjä Genomitiedon vaikutus terveydenhuoltoon työpaja 7.11.2014 Sitra, Helsinki Jaakko Ignatius, TYKS Kliininen genetiikka Perimän

Lisätiedot

KOE-ELÄINTEN ASIALLA

KOE-ELÄINTEN ASIALLA KOE-ELÄINTEN ASIALLA Eläinkokeet ovat arkipäivää Maailmassa käytetään vuosittain eläinkokeisiin yli sata miljoonaa eläintä, joista EU:n osuus on runsaat 10 miljoonaa koe-eläintä. Suomessa käytettyjen koe-eläinten

Lisätiedot

BIOLOGIA 1. kurssi 7. luokka

BIOLOGIA 1. kurssi 7. luokka 1. kurssi 7. luokka Kurssin tavoitteena on ohjata oppilasta ymmärtämään elämän perusilmiöitä ja vesiekosysteemien rakennetta ja toimintaa. Tavoitteena on, että oppilas oppii tunnistamaan ja luokittelemaan

Lisätiedot

Diabeetikon ruokailu sairaalassa

Diabeetikon ruokailu sairaalassa Diabeetikon ruokailu sairaalassa { Ravitsemusterapeutti Roope Mäkelä Satks Ruokavaliosuositus Diabeetikoille suositellaan samanlaista ruokaa kuin koko väestölle Ravitsemushoito on oleellinen osa diabeteksen

Lisätiedot

Rekisterit tutkimusaineistona: tieteenfilosofis-metodologiset lähtökohdat

Rekisterit tutkimusaineistona: tieteenfilosofis-metodologiset lähtökohdat Reijo Sund Rekisterit tutkimusaineistona: tieteenfilosofis-metodologiset lähtökohdat Rekisterit tutkimuksen apuvälineenä kurssi, Biomedicum, Helsinki 25.05.2009 Kevät 2009 Rekisterit tutkimusaineistona

Lisätiedot

Vähennä energian kulutusta ja kasvata satoa kasvihuoneviljelyssä

Vähennä energian kulutusta ja kasvata satoa kasvihuoneviljelyssä Avoinkirje kasvihuoneviljelijöille Aiheena energia- ja tuotantotehokkuus. Vähennä energian kulutusta ja kasvata satoa kasvihuoneviljelyssä Kasvihuoneen kokonaisenergian kulutusta on mahdollista pienentää

Lisätiedot

Ketogeeninen ruokavalio

Ketogeeninen ruokavalio Ketogeeninen ruokavalio Ketogeeninen ruokavalio on hiilihydraattien korvaamista terveellisillä rasvoilla ja kohtuullisella korkealaatuisten proteiinien kulutuksella. Tällaista ruokavaliota tutkitaankin

Lisätiedot

Pitääkö murtunut jalkani leikata? Mitä röntgenkuvissa näkyy? Mitä laboratoriokokeet osoittavat? Pitääkö minun olla syömättä ennen laboratoriokokeita?

Pitääkö murtunut jalkani leikata? Mitä röntgenkuvissa näkyy? Mitä laboratoriokokeet osoittavat? Pitääkö minun olla syömättä ennen laboratoriokokeita? '' Pitääkö murtunut jalkani leikata? Mitä röntgenkuvissa näkyy? Mitä laboratoriokokeet osoittavat? Pitääkö minun olla syömättä ennen laboratoriokokeita? Kuinka kauan kipsiä pidetään jalassa? Saako kipeälle

Lisätiedot

Mevalonaattikinaasin vajaatoiminta (MKD) ja Hyperimmunoglobulinemia D-oireyhtymä (HIDS)

Mevalonaattikinaasin vajaatoiminta (MKD) ja Hyperimmunoglobulinemia D-oireyhtymä (HIDS) Mevalonaattikinaasin vajaatoiminta (MKD) ja Hyperimmunoglobulinemia D-oireyhtymä (HIDS) Mikä on Mevalonaattikinaasin vajaatoiminta? Mevalonaattikinaasin vajaatoiminta on perinnöllinen sairaus. Se on elimistön

Lisätiedot

Kuka on näkövammainen?

Kuka on näkövammainen? Näkövammat 1 Sisältö Kuka on näkövammainen? 3 Millaisia näkövammat ovat? 4 Näöntarkkuus 4 Näkökenttä 4 Kontrastien erotuskyky 6 Värinäkö 6 Silmien mukautuminen eri etäisyyksille 6 Silmien sopeutuminen

Lisätiedot

Hevosten rokottaminen. Eläinlääkäri Martti Nevalainen Intervet Oy, osa Schering-Plough konsernia

Hevosten rokottaminen. Eläinlääkäri Martti Nevalainen Intervet Oy, osa Schering-Plough konsernia Hevosten rokottaminen Eläinlääkäri Martti Nevalainen Intervet Oy, osa Schering-Plough konsernia Miksi rokotuttaa hevosia? Pyritään ennaltaehkäisemään tai lieventämään tartuntatauteja, jotka saattavat aiheuttaa

Lisätiedot

Ohjeita opetukseen ja odotettavissa olevat tulokset

Ohjeita opetukseen ja odotettavissa olevat tulokset Ohjeita opetukseen ja odotettavissa olevat tulokset Ensimmäinen sivu on työskentelyyn orientoiva johdatteluvaihe, jossa annetaan jotain tietoja ongelmista, joita happamat sateet aiheuttavat. Lisäksi esitetään

Lisätiedot

VASTASYNTYNEIDEN HARVINAISTEN SYNNYNNÄISTEN AINEENVAIHDUNTA- SAIRAUKSIEN SEULONTA

VASTASYNTYNEIDEN HARVINAISTEN SYNNYNNÄISTEN AINEENVAIHDUNTA- SAIRAUKSIEN SEULONTA VASTASYNTYNEIDEN HARVINAISTEN SYNNYNNÄISTEN AINEENVAIHDUNTA- SAIRAUKSIEN SEULONTA Synnynnäiset aineenvaihduntasairaudet Harvinaisia, periytyviä sairauksia Esiintyvyys < 1:2000 Oireet ilmenevät yleensä

Lisätiedot

KOE 6 Biotekniikka. 1. Geenien kloonaus plasmidien avulla.

KOE 6 Biotekniikka. 1. Geenien kloonaus plasmidien avulla. Esseekysymyksistä 1-2 voi saada enintään 9 pistettä/kysymys. Vastauksia pisteytettäessä huomioidaan asiatiedot, joista voi saada enintään 7 pistettä. Lisäksi vastaaja saa enintään kaksi pistettä, mikäli

Lisätiedot

Betonikivien soveltuvuus ajoneuvoliikennealueille

Betonikivien soveltuvuus ajoneuvoliikennealueille Betonikivien soveltuvuus ajoneuvoliikennealueille Betonikiviä on käytetty Suomessa päällystämiseen jo 1970-luvulta lähtien. Niiden käyttöä perusteltiin muun muassa asfalttia paremmalla kulutuskestävyydellä,

Lisätiedot

Suomen Lihastautirekisteri osana kansainvälistä yhteistyötä. Jaana Lähdetie Erikoislääkäri, Suomen Lihastautirekisterin vastuuhenkilö TYKS

Suomen Lihastautirekisteri osana kansainvälistä yhteistyötä. Jaana Lähdetie Erikoislääkäri, Suomen Lihastautirekisterin vastuuhenkilö TYKS Suomen Lihastautirekisteri osana kansainvälistä yhteistyötä Jaana Lähdetie Erikoislääkäri, Suomen Lihastautirekisterin vastuuhenkilö TYKS Taustaa Miksi uudet tutkimustulokset lihastautien perimmäisistä

Lisätiedot

Kaaoksen hallinta (perus)terveydenhuollossa. 17.4.2013 Klas Winell

Kaaoksen hallinta (perus)terveydenhuollossa. 17.4.2013 Klas Winell Kaaoksen hallinta (perus)terveydenhuollossa 17.4.2013 Klas Winell Rakennuspalikat Omien resurssien analyysi Kohdeväestön analyysi Nykyisen toiminnan määrä, laatu, vaikuttavuus ja terveyshyöty analyysi

Lisätiedot

Tyypin 2 diabetes Hoito-ohje ikääntyneille Ruokavalio ja liikunta. Sairaanhoitajaopiskelijat Lauri Tams ja Olli Vaarula

Tyypin 2 diabetes Hoito-ohje ikääntyneille Ruokavalio ja liikunta. Sairaanhoitajaopiskelijat Lauri Tams ja Olli Vaarula Tyypin 2 diabetes Hoito-ohje ikääntyneille Ruokavalio ja liikunta Sairaanhoitajaopiskelijat Lauri Tams ja Olli Vaarula 1 Johdanto Arviolta 500 000 suomalaista sairastaa diabetesta ja määrä kasvaa koko

Lisätiedot

TerveysInfo. Ataksiaoireyhtymät : tietoa etenevistä ataksiasairauksista Perustietoa ataksiasairaudesta sekä sairauden hoidosta ja kuntoutuksesta.

TerveysInfo. Ataksiaoireyhtymät : tietoa etenevistä ataksiasairauksista Perustietoa ataksiasairaudesta sekä sairauden hoidosta ja kuntoutuksesta. TerveysInfo MS tauti Ataksiaoireyhtymät : tietoa etenevistä ataksiasairauksista Perustietoa ataksiasairaudesta sekä sairauden hoidosta ja kuntoutuksesta. 1996 5, A5 : 46 s. : piirr. : 2 väri Hakusanat:

Lisätiedot

MUUTOKSET ELEKTRONI- RAKENTEESSA

MUUTOKSET ELEKTRONI- RAKENTEESSA MUUTOKSET ELEKTRONI- RAKENTEESSA KEMIAA KAIK- KIALLA, KE1 Ulkoelektronit ja oktettisääntö Alkuaineen korkeimmalla energiatasolla olevia elektroneja sanotaan ulkoelektroneiksi eli valenssielektroneiksi.

Lisätiedot